Recombinant Human ATP-binding cassette sub-family G member 4 (ABCG4)

Shipped with Ice Packs
In Stock

Description

Functional Roles

ABCG4 functions as a lipid transporter influencing cellular cholesterol homeostasis and Aβ clearance:

  • Lipid Transport: Facilitates efflux of desmosterol (a cholesterol precursor) and cholesterol to HDL particles .

  • Amyloid-Beta Clearance: Mediates Aβ export at the blood-brain barrier (BBB), potentially reducing Alzheimer’s disease-linked peptide accumulation .

  • Inhibitors: Probucol and L-thyroxine block ABCG4-mediated transport, suggesting therapeutic modulation potential .

Research Applications

Recombinant ABCG4 is utilized in:

  • Western Blot (WB) and ELISA for protein detection .

  • Crystallization studies to resolve structural mechanisms .

  • In Vitro Transport Assays to evaluate lipid and Aβ efflux .

Mechanistic Insights

  • Dimerization: ABCG4 forms homodimers or heterodimers with ABCG1, critical for sterol transport .

  • Substrate Competition: Desmosterol and Aβ bind at overlapping sites, suggesting a shared transport mechanism .

  • Structural Modeling: Homology models predict two Aβ-binding sites and one alternating sterol-binding cleft .

Challenges and Limitations

  • Functional Variability: Activity assays remain challenging due to protein instability post-reconstitution .

  • Therapeutic Relevance: Despite in vitro promise, in vivo studies show limited impact on Alzheimer’s pathology .

Future Directions

  • Drug Development: Targeting ABCG4 with modulators to enhance Aβ clearance or regulate lipid metabolism .

  • Structural Studies: Cryo-EM or X-ray crystallography to resolve full-length ABCG4 architecture .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please specify them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Kindly contact your local distributor for precise delivery estimates.
Please note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize the development of the specified tag.
Synonyms
ABCG4; WHITE2; ATP-binding cassette sub-family G member 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-646
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ABCG4
Target Protein Sequence
MAEKALEAVGCGLGPGAVAMAVTLEDGAEPPVLTTHLKKVENHITEAQRFSHLPKRSAVD IEFVELSYSVREGPCWRKRGYKTLLKCLSGKFCRRELIGIMGPSGAGKSTFMNILAGYRE SGMKGQILVNGRPRELRTFRKMSCYIMQDDMLLPHLTVLEAMMVSANLKLSEKQEVKKEL VTEILTALGLMSCSHTRTALLSGGQRKRLAIALELVNNPPVMFFDEPTSGLDSASCFQVV SLMKSLAQGGRTIICTIHQPSAKLFEMFDKLYILSQGQCIFKGVVTNLIPYLKGLGLHCP TYHNPADFIIEVASGEYGDLNPMLFRAVQNGLCAMAEKKSSPEKNEVPAPCPPCPPEVDP IESHTFATSTLTQFCILFKRTFLSILRDTVLTHLRFMSHVVIGVLIGLLYLHIGDDASKV FNNTGCLFFSMLFLMFAALMPTVLTFPLEMAVFMREHLNYWYSLKAYYLAKTMADVPFQV VCPVVYCSIVYWMTGQPAETSRFLLFSALATATALVAQSLGLLIGAASNSLQVATFVGPV TAIPVLLFSGFFVSFKTIPTYLQWSSYLSYVRYGFEGVILTIYGMERGDLTCLEERCPFR EPQSILRALDVEDAKLYMDFLVLGIFFLALRLLAYLVLRYRVKSER
Uniprot No.

Target Background

Function
ATP-dependent transporter of the ATP-binding cassette (ABC) family. ABCG4 is potentially involved in the cellular efflux of sterols, particularly cholesterol and desmosterol (a cholesterol precursor), to high-density lipoprotein (HDL). This transporter may play a crucial role in the removal of amyloid-beta peptides from the brain, a process that can be inhibited by desmosterol. However, it remains unclear whether ABCG4 directly transports amyloid-beta peptides or if the peptide export is facilitated due to alterations in the membrane lipid environment. ABCG4 has been shown to induce apoptosis in various cell types.
Gene References Into Functions
  1. Modulation of miR-185-5p expression by EBV-miR-BART6 contributes to developmental differences in ABCG4 gene expression in human megakaryocytes. PMID: 27816548
  2. ABCG1 and ABCG4 alter the distribution of gamma-secretase on the plasma membrane, leading to decreased gamma-secretase activity and suppressed Abeta secretion. PMID: 27196068
  3. Both the full-length and the short isoforms of ABCG1 can dimerize with ABCG4, while the ABCG2 multidrug transporter is unable to form a heterodimer with ABCG4. PMID: 27228027
  4. Research suggests that high ABCG4 expression is associated with a poorer prognosis in patients with non-small-cell lung cancer in advanced stages. PMID: 26270652
  5. HUWE1 and NEDD4-1 are two E3 ligases that are essential enzymes in the post-translational regulation of ABCG1 and ABCG4 protein levels and cellular cholesterol export activity. PMID: 26296893
  6. These findings indicate that ABCA1, ABCG1, and ABCG4 are localized to distinct membrane meso-domains and disrupt these meso-domain structures by reorganizing lipids on the plasma membrane. PMID: 25302608
  7. This study demonstrates that Abcg4 acts in concert with Abcg2 to efflux Abeta from the brain across the blood-brain barrier. PMID: 22391220
  8. Human and mouse orthologs of a new ATP-binding cassette gene, ABCG4: maps to human chromosome 11, is expressed abundantly in the brain, and has alternatively-spliced isoforms. PMID: 11856881
  9. ABCG4 is specifically expressed in the brain and the eye. PMID: 12183068
  10. ABCG1 and ABCG4 collaborate with ABCA1 to maximize the removal of excess cholesterol from cells and generate cholesterol-rich lipoprotein particles. PMID: 16902247
  11. ABCG4 is highly expressed in microglia within Alzheimer's disease brains. PMID: 18508037
  12. Human ABC transporters ABCG2 (BCRP) and ABCG4. PMID: 18668433
  13. ABCG4 might be involved in macrophage lipid homeostasis. PMID: 11606068
Database Links

HGNC: 13884

OMIM: 607784

KEGG: hsa:64137

STRING: 9606.ENSP00000304111

UniGene: Hs.126378

Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed specifically in the brain and the eye.

Q&A

What is ABCG4 and where is it primarily expressed?

ABCG4 is a member of the ATP-binding cassette transporter family that regulates cholesterol homeostasis. It is predominantly expressed in the central nervous system (CNS), with notable expression in neurons, astrocytes, microglia, and capillary endothelial cells at the blood-brain barrier (BBB). The protein consists of 646 amino acids in humans and functions as a transporter involved in cholesterol efflux from the brain. Its expression pattern suggests specialized roles in maintaining CNS lipid homeostasis distinct from its family members.

What are the basic structural features of the ABCG4 protein?

The full-length human ABCG4 protein (Q9H172) spans 646 amino acids and contains characteristic domains of the ABC transporter family, including nucleotide-binding domains that interact with ATP. Like other ABCG subfamily members, ABCG4 likely functions as a dimer, with each monomer containing six transmembrane domains and an intracellular ATP-binding cassette. For recombinant protein production, ABCG4 can be successfully expressed in E. coli with an N-terminal His tag to facilitate purification and experimental manipulation.

What are the proposed physiological functions of ABCG4?

Multiple physiological functions have been attributed to ABCG4 based on experimental evidence. These include:

  • Cholesterol and sterol transport, particularly efflux from the brain

  • Potential role in amyloid-β (Aβ) peptide efflux from the brain at the blood-brain barrier

  • Possible inhibition of γ-secretase activity, thereby reducing Aβ production

  • Potential function in glucose-stimulated insulin secretion (GSIS)

These roles position ABCG4 at the intersection of lipid metabolism, glucose homeostasis, and neurodegenerative processes.

How should researchers design knockout studies to investigate ABCG4 function?

When designing knockout studies for ABCG4, researchers should consider several critical factors:

  • Selection of appropriate genetic background: The choice of background strain is crucial as different strains may have varying baseline phenotypes that could mask or enhance ABCG4-related effects.

  • Use of complementary disease models: For studying ABCG4 in disease contexts, consider breeding ABCG4 knockout mice with established disease models (such as APP transgenic mice for Alzheimer's disease studies).

  • Comprehensive phenotyping: Include behavioral, biochemical, and histological assessments. For example, in AD-related studies, employ cognitive tests (Novel Object Recognition, Novel Object Placement), metabolic assessments (GTT, ITT), and histopathological analyses of relevant brain regions.

  • Temporal considerations: Assess phenotypes at multiple time points to detect potentially age-dependent effects, as some ABCG4-related phenotypes may develop only with aging or disease progression.

  • Control for compensatory mechanisms: Consider potential upregulation of related transporters (such as ABCG1) that might compensate for ABCG4 loss.

What methodologies are effective for measuring ABCG4-mediated transport activity?

Effective methodologies for measuring ABCG4-mediated transport include:

  • In vitro cell-based assays:

    • Stable cell lines expressing ABCG4 (or mutant variants)

    • Measurement of cholesterol/sterol efflux using radioisotope-labeled substrates

    • Assessment of substrate accumulation inside cells versus media

  • In vivo clearance studies:

    • Injection of radiolabeled potential substrates (e.g., Aβ peptides) into the brain

    • Measurement of substance clearance rates comparing wild-type and ABCG4 knockout animals

    • Inclusion of non-transported control substances (like inulin) to account for passive clearance

  • Vesicular transport assays:

    • Preparation of membrane vesicles from cells expressing ABCG4

    • Assessment of ATP-dependent transport of fluorescently or radioisotope-labeled substrates

For accurate results, researchers should include appropriate controls for non-specific transport and consider potential interactions with other transporters.

How does ABCG4 potentially contribute to Alzheimer's disease pathology?

The potential relationship between ABCG4 and Alzheimer's disease involves several hypothesized mechanisms:

  • Aβ clearance: ABCG4 has been suggested to play a role in the efflux of Aβ peptides from the brain across the blood-brain barrier. In vitro and in vivo studies have implicated ABCG4 in this process, though knockout studies have yielded mixed results.

  • Cholesterol homeostasis: Since cholesterol accumulates in senile plaques and can increase Aβ production, ABCG4's role in cholesterol efflux might indirectly affect AD pathogenesis.

  • γ-secretase regulation: In vitro studies have found that ABCG4 can inhibit γ-secretase activity, potentially reducing Aβ production. This suggests a protective role against AD development.

  • Sterol metabolism: ABCG4 exports desmosterol (a cholesterol precursor) from the brain. Since desmosterol can inhibit Aβ clearance, ABCG4 dysfunction might contribute to Aβ accumulation through this mechanism.

Despite these hypothesized connections, experimental evidence from ABCG4 knockout studies crossed with AD mouse models (APP Swe,Ind/J9) did not demonstrate exacerbation of the AD phenotype, suggesting compensatory mechanisms may exist or that ABCG4's role might require additional pathogenic factors to manifest.

What behavioral and histological assessments are most informative when studying ABCG4 in neurodegeneration models?

When studying ABCG4 in neurodegeneration models, researchers should consider multiple assessment approaches:

  • Behavioral assessments:

    • Novel Object Recognition (NOR): Tests recognition memory

    • Novel Object Placement (NOP): Evaluates spatial memory

    • Open Field Test: Assesses general locomotor activity and anxiety-like behavior

    • Contextual memory tests: Particularly relevant as ABCG4-/- mice were reported to have contextual memory deficits

  • Histological assessments:

    • Thioflavin S staining: Visualizes and quantifies amyloid plaques

    • Regional analysis: Separate assessment of whole brain versus hippocampus is recommended

    • Morphological analysis of neurons and glial cells: Evaluates potential cellular changes

    • Markers of neuroinflammation: Given ABCG4's expression in microglia and astrocytes

  • Timeline considerations:

    • Early assessment (6-7 months) and later assessment (16-19 months) to track progressive changes

    • Correlation of behavioral deficits with histopathological findings

These multimodal assessments provide comprehensive insights into potential neurodegenerative phenotypes related to ABCG4 dysfunction.

How does ABCG4 interact with glucose metabolism and insulin signaling?

The relationship between ABCG4 and glucose metabolism appears complex:

These observations suggest that ABCG4 may have subtle, age and sex-dependent effects on energy metabolism and glucose homeostasis, though the underlying mechanisms remain to be fully elucidated.

What methodological approaches should be used to assess metabolic effects of ABCG4 manipulation?

To comprehensively assess metabolic effects of ABCG4 manipulation, researchers should employ the following methodological approaches:

  • Longitudinal monitoring:

    • Regular body weight measurements (e.g., monthly)

    • Body composition analysis every 2-4 months using techniques like NMR or DEXA scanning

    • Food intake monitoring

  • Metabolic cage studies:

    • Energy expenditure measurement via indirect calorimetry

    • Activity monitoring

    • Respiratory exchange rate (RER) calculation to assess fuel preference

    • Analysis of relationship between energy expenditure and body weight

  • Glucose homeostasis assessment:

    • Glucose tolerance tests (GTT): Measure blood glucose at 0, 15, 30, 60, and 120 minutes after glucose administration

    • Insulin tolerance tests (ITT): Assess insulin sensitivity by measuring blood glucose response to insulin injection

    • Area under the curve (AUC) calculations for comprehensive analysis

  • Age and sex considerations:

    • Perform assessments at multiple age points (e.g., 8-12 months and 16-19 months)

    • Analyze male and female subjects separately

    • Consider potential sex hormone interactions with ABCG4 function

  • Molecular analyses:

    • Tissue-specific insulin signaling pathway analysis

    • Pancreatic islet morphology and insulin content assessment

    • Lipid profiling in metabolically relevant tissues

This multiparameter approach allows for detection of subtle and potentially tissue-specific metabolic effects of ABCG4 manipulation.

What expression systems are optimal for producing functional recombinant ABCG4 protein?

The choice of expression system for recombinant ABCG4 protein depends on the intended experimental application:

  • E. coli expression:

    • Suitable for producing full-length human ABCG4 with N-terminal His tags

    • Advantages: High yield, cost-effective, relatively simple protocol

    • Limitations: May lack post-translational modifications; potential folding issues with transmembrane regions

    • Application: Useful for structural studies, antibody production, and protein-protein interaction studies

  • Mammalian cell expression:

    • HEK293 or CHO cells are recommended for full post-translational modifications

    • Advantages: Proper folding and processing of mammalian membrane proteins

    • Limitations: Lower yield, more expensive, technically demanding

    • Application: Functional transport assays, cell surface expression studies

  • Insect cell expression:

    • Baculovirus-infected Sf9 or High Five cells

    • Advantages: Higher yield than mammalian cells with more mammalian-like modifications than E. coli

    • Limitations: Complex glycosylation differs from mammalian patterns

    • Application: Structural studies requiring properly folded protein in higher quantities

When expressing ABCG4, researchers should consider including appropriate tags (His, FLAG) for purification while ensuring these do not interfere with transporter function if conducting functional studies.

What are the critical quality control parameters for recombinant ABCG4 protein preparations?

To ensure high-quality recombinant ABCG4 protein preparations, researchers should implement these quality control parameters:

  • Purity assessment:

    • SDS-PAGE analysis: Greater than 90% purity is recommended

    • Western blot confirmation using specific ABCG4 antibodies

    • Mass spectrometry for definitive identification and detection of potential truncations

  • Conformational integrity:

    • Circular dichroism (CD) spectroscopy to verify secondary structure

    • Limited proteolysis to assess folding status

    • Fluorescence-based thermal shift assays to evaluate protein stability

  • Functional verification:

    • ATPase activity assays to confirm ATP binding and hydrolysis

    • Transport assays using known substrates (if applicable)

    • Ligand binding studies to assess interaction with cholesterol or other sterols

  • Storage stability:

    • Freeze-thaw testing (repeated freezing and thawing is not recommended)

    • Stability at 4°C for working aliquots

    • Determination of optimal buffer conditions for long-term storage

  • Batch consistency:

    • Lot-to-lot comparison of key parameters

    • Reference standards for comparative analysis

Implementing these quality control measures ensures that experimental results obtained with recombinant ABCG4 protein are reliable and reproducible.

How might ABCG4 function be affected by interactions with its binding partners?

ABCG4 function is likely influenced by protein-protein interactions that regulate its activity, localization, and substrate specificity:

  • ABCG1 partnership:

    • ABCG4 can form heterodimers with its close relative ABCG1

    • This natural binding partnership may explain compensatory mechanisms observed in ABCG4 knockout studies

    • Research should investigate whether ABCG1/ABCG4 heterodimers have different substrate specificity or transport efficiency compared to homodimers

  • Cholesterol homeostasis regulators:

    • Interactions with sterol regulatory element-binding proteins (SREBPs)

    • Liver X receptor (LXR) activation influences ABCG4 expression

    • Investigations into whether these regulators physically interact with ABCG4 or only affect its expression would be valuable

  • Neuronal proteins:

    • Given ABCG4's expression in neurons, interactions with neuron-specific proteins might modulate its function

    • Particularly relevant to investigate interactions with proteins involved in Aβ production or processing like APP, BACE1, or components of γ-secretase

  • Methodological approaches to study interactions:

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling techniques (BioID, APEX)

    • Mammalian two-hybrid or split-luciferase complementation assays

Understanding these interactions could explain the apparently contradictory results between in vitro studies suggesting ABCG4's role in Aβ efflux and in vivo knockout studies showing no effect on AD phenotype.

What mechanisms might compensate for ABCG4 deficiency in knockout models?

The lack of exacerbated AD phenotype in ABCG4 knockout models suggests robust compensatory mechanisms:

  • Upregulation of related transporters:

    • ABCG1, which shares 72% amino acid identity with ABCG4, may be upregulated

    • Other ABC transporters involved in cholesterol transport (ABCA1) or Aβ transport (ABCB1/P-glycoprotein)

    • LRP1 and LRP2, known to mediate Aβ efflux, might compensate for ABCG4 loss

  • Altered cholesterol metabolism pathways:

    • Changes in sterol synthesis or metabolism enzymes

    • Modifications in cholesterol trafficking between cellular compartments

    • Adjustments in desmosterol metabolism, which ABCG4 normally regulates

  • Alternative Aβ clearance mechanisms:

    • Enhanced degradation by Aβ-degrading enzymes

    • Increased phagocytosis by microglia

    • Modified interstitial fluid flow affecting Aβ clearance

  • Methodological approaches to identify compensatory mechanisms:

    • Transcriptomic and proteomic profiling comparing wild-type and ABCG4-/- tissues

    • Functional transport assays in cells and tissues from knockout models

    • Conditional and inducible knockout models to distinguish developmental compensation from acute responses

    • Double or triple knockout models (e.g., ABCG4/ABCG1 double knockout)

Identifying these compensatory mechanisms could reveal new therapeutic targets for disorders involving impaired cholesterol homeostasis or Aβ accumulation.

What are the current knowledge gaps in ABCG4 research?

Despite significant progress in understanding ABCG4, several important knowledge gaps remain:

  • Precise substrate specificity:

    • While ABCG4 is known to transport cholesterol and possibly Aβ, the complete range of physiological substrates remains unclear

    • Structural determinants of substrate recognition are poorly understood

  • Regulatory mechanisms:

    • Tissue-specific regulation of ABCG4 expression

    • Post-translational modifications affecting ABCG4 function

    • Subcellular trafficking and membrane localization dynamics

  • Biological significance:

    • Seemingly contradictory results between in vitro studies suggesting important roles and in vivo knockout studies showing minimal phenotypes

    • Potential redundancy with other transporters needs further investigation

    • Sex-specific differences in ABCG4 function require explanation

  • Therapeutic potential:

    • Whether ABCG4 modulation could be therapeutically beneficial in neurological or metabolic disorders

    • Potential for targeted drug delivery across the blood-brain barrier utilizing ABCG4

Addressing these knowledge gaps would significantly advance our understanding of ABCG4 biology and its potential relevance to human health and disease.

What future research directions should be prioritized for ABCG4 investigation?

Based on current knowledge and remaining gaps, these research directions should be prioritized:

  • Comprehensive substrate identification:

    • Untargeted metabolomics comparing wild-type and ABCG4-/- tissues

    • High-throughput screening of potential substrates using vesicular transport assays

    • Structure-function studies to define substrate binding domains

  • Human genetic studies:

    • Association of ABCG4 variants with neurodegenerative diseases and metabolic disorders

    • Functional characterization of naturally occurring ABCG4 variants

    • Single-cell transcriptomics to understand cell-type-specific expression patterns in human brain

  • Advanced animal models:

    • Tissue-specific and inducible ABCG4 knockout models

    • Humanized ABCG4 models to better reflect human physiology

    • Combined genetic models targeting multiple related transporters

  • Interaction with environmental factors:

    • Effects of high-fat diet, aging, or other stressors on ABCG4 function

    • Interactions between ABCG4 and environmental risk factors for neurodegeneration

  • Translational approaches:

    • Development of specific ABCG4 modulators (activators or inhibitors)

    • Investigation of ABCG4 as a potential drug delivery vehicle to the CNS

    • Biomarker studies in patients with neurological or metabolic disorders

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.