Recombinant Human ATP-binding cassette sub-family G member 5 (ABCG5)

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Production

Recombinant Human ABCG5 refers to the protein produced using heterologous expression systems (e.g., E. coli, yeast, or mammalian cells) to replicate the native ATP-dependent sterol transport activity. The protein contains a nucleotide-binding domain (NBD) and transmembrane domain (TMD), requiring co-expression with ABCG8 for functional maturation .

Key Sterol-Binding Residues

SiteResidues (ABCG5/ABCG8)Functional Impact
1Gln425/G8-Asn568Initial sterol capture
2Ile395/G8-Phe561Critical for cholesterol efflux; mutations reduce transport by >50%

Functional Roles in Sterol Homeostasis

ABCG5/ABCG8 mediates biliary cholesterol secretion and limits intestinal sterol absorption:

  • Knockout Mice:

    • Biliary cholesterol reduced to 9% of wild-type levels .

    • Plasma sitosterol increased 30-fold .

  • Overexpression:

    • Biliary cholesterol secretion increased 5-fold .

    • Fecal neutral sterol excretion tripled .

Clinical and Pathological Relevance

Mutations in ABCG5 cause sitosterolemia, characterized by:

  • Symptoms: Hypercholesterolemia, xanthomas, premature atherosclerosis .

  • Genetic Screening: 14 pathogenic variants identified in Brazilian cohorts, linked to early ASCVD .

Therapeutic Response

InterventionLDL-C ReductionSource
Ezetimibe + diet40–60%

Challenges and Future Directions

  • Expression Limitations: Functional studies require co-expression with ABCG8 .

  • Therapeutic Targets: Modulating ABCG5/ABCG8 activity could treat atherosclerosis or cholestasis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing the order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary based on your purchasing method or location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
ABCG5; ATP-binding cassette sub-family G member 5; Sterolin-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-651
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MGDLSSLTPGGSMGLQVNRGSQSSLEGAPATAPEPHSLGILHASYSVSHRVRPWWDITSC RQQWTRQILKDVSLYVESGQIMCILGSSGSGKTTLLDAMSGRLGRAGTFLGEVYVNGRAL RREQFQDCFSYVLQSDTLLSSLTVRETLHYTALLAIRRGNPGSFQKKVEAVMAELSLSHV ADRLIGNYSLGGISTGERRRVSIAAQLLQDPKVMLFDEPTTGLDCMTANQIVVLLVELAR RNRIVVLTIHQPRSELFQLFDKIAILSFGELIFCGTPAEMLDFFNDCGYPCPEHSNPFDF YMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICHKTLKNIERMKHLKTLPMVPFKTKD SPGVFSKLGVLLRRVTRNLVRNKLAVITRLLQNLIMGLFLLFFVLRVRSNVLKGAIQDRV GLLYQFVGATPYTGMLNAVNLFPVLRAVSDQESQDGLYQKWQMMLAYALHVLPFSVVATM IFSSVCYWTLGLHPEVARFGYFSAALLAPHLIGEFLTLVLLGIVQNPNIVNSVVALLSIA GVLVGSGFLRNIQEMPIPFKIISYFTFQKYCSEILVVNEFYGLNFTCGSSNVSVTTNPMC AFTQGIQFIEKTCPGATSRFTMNFLILYSFIPALVILGIVVFKIRDHLISR
Uniprot No.

Target Background

Function
ABCG5 and ABCG8 form an obligate heterodimer that mediates Mg(2+)- and ATP-dependent sterol transport across the cell membrane. It plays a crucial role in the selective transport of dietary plant sterols and cholesterol in and out of enterocytes, and in the selective excretion of sterols by the liver into bile. This process is essential for maintaining normal sterol homeostasis. The heterodimer with ABCG8 exhibits ATPase activity.
Gene References Into Functions
  1. Case Report/Review: novel variants of the ABCG5 gene causing xanthelasmas and macrothrombocytopenia in sitosterolemia. PMID: 28696550
  2. Mutation-negative familial hypercholesterolemia subjects accumulate an excess of rare and common gene variations in ABCG5/G8 genes PMID: 29066094
  3. Case Reports: compound heterozygous for nonsense mutations in ABCG5 responsible for sitosterolemia. PMID: 28521186
  4. ABCG5 gene variants were not associated with cholelithiasis in patients with Gaucher disease type 1. PMID: 27981300
  5. Genetic variations in ABCG5, CYP7A1, and DHCR7 may contribute to differing responses of serum cholesterol to dairy intake among healthy adults. PMID: 27052530
  6. ABCG5 Gene Variants are associated with Sitosterolemia and Familial Mediterranean Fever. PMID: 27170062
  7. first case of a Mexican family with sitosterolemia carrying two new ABCG5 gene mutations PMID: 26892138
  8. Genetic polymorphism within the ABCG5 gene is a risk factor for diabetes. PMID: 26088706
  9. crystallization in lipid bilayers to determine the X-ray structure of human G5G8 in a nucleotide-free state at 3.9 A resolution, generating the first atomic model of an ABC sterol transporter PMID: 27144356
  10. ATP-binding cassette (ABC) transporters G5 (ABCG5) and G8 (ABCG8) form an obligate heterodimer that limits intestinal absorption and facilitates biliary secretion of cholesterol and phytosterols. PMID: 24252657
  11. ABCG5/8 variants are associated with susceptibility to coronary heart disease. PMID: 24691589
  12. Sitosterolemia is caused by a genetic defect of sterolins (ABCG5/ABCG8) mapped to the STSL locus. Polymorphic variations in STSL have been linked to lipid levels and gallstone disease PMID: 24811295
  13. HRD1 and RMA1 may therefore be negative regulators of disease-associated transporter ABCG5/ABCG8. PMID: 24584735
  14. No association of T400K and Y54C polymorphism with hepatic ABCG8/G5 mRNA expression. PMID: 24498041
  15. MI and gallstones, 2 seemingly unrelated diseases, are intrinsically linked via the function of the ABCG5/8 cholesterol transporter. PMID: 24657701
  16. A novel mutation of ABCG5 gene in a Turkish boy with phytosterolemia presenting with macrotrombocytopenia and stomatocytosis. PMID: 24623560
  17. The evolutionary conserved region of ABCG5 were found to be responsive to the Liver-X-Receptor. PMID: 23790976
  18. ABCG5-R50C variant associated with cholesterol gallstone disease PMID: 22898925
  19. The sterol transporters ABCA1, ABCG5, and ABCG8 may play a role in the pathogenesis of human cholesterol related gallbladder diseases. PMID: 23179156
  20. The associations of four ABCG5/G8 single nucleotide polymorphisms and serum lipid levels are different between the Mulao and Han populations in China, or between males and females. PMID: 22655090
  21. A systematic review and meta-analysis of ABCG5 polymorphisms and association with markers of cholesterol metabolism. PMID: 20581104
  22. The effects of ABCG5/G8 polymorphisms on HDL-cholesterol concentrations depend on ABCA1 genetic variants. PMID: 19692220
  23. Genetic variations at ABCG5/G8 genes modulate plasma lipids concentrations in patients with familial hypercholesterolemia PMID: 20172523
  24. an ABCG5-G8 haplotype, which included the rs6544718 T allele, was associated with higher HDLcholesterol plasma concentrations in women. PMID: 20170916
  25. five Chinese children from four separate families presented with sitosterolemia in whom we identified two new (Y329X, G269R) and three known (R446X, N437K, R389H) mutations in the ABCG5 gene PMID: 20521169
  26. Bile acids may promote an active conformation of purified ABCG5/G8 either by global stabilization of the transporter or by binding to a specific site on ABCG5/G8. PMID: 20210363
  27. ABCG5/G8 polymorphisms are not associated with reduction of serum lipids by soy or dietary fiber in hyperlipidemic Mexican subjects PMID: 19917453
  28. mutations in ATP-binding cassette proteins G5 (ABCG5) and G8 (ABCG8) causing sitosterolemia PMID: 11668628
  29. New mutations - R419H and IVS12+1G -->A. (Latter is splice site mutation.) PMID: 11855938
  30. In a sitosterolemia patient a novel heterozygous mutation has been found in exon 8 of the ABCG5 gene leading to a premature termination of the protein (Arg408Ter). PMID: 12124998
  31. several potential regulatory elements were found for the ABCG5 and ABCG8 genes, and the intergenic region was found to act as a bidirectional promoter PMID: 12150943
  32. Role of ABCG5 and ABCG8 in cholesterol secretion and absorption PMID: 12208868
  33. ABCG5 and ABCG8 function as obligate heterodimers to promote sterol excretion into bile PMID: 14504269
  34. in patients with hypercholesterolemia, the ABCG8 D19H variant is associated with greater LDLC-lowering response to atorvastatin therapy PMID: 14703505
  35. LRH-1 is a positive transcription factor for ABCG5 and ABCG8 and, in conjunction with studies on LRH-1 activation of other promoters, identify LRH-1 as a "master regulator" for genes involved in sterol and bile acid secretion from liver and intestine PMID: 15121760
  36. ABCGG5 and ABCG8 are required to modulate biliary cholesterol secretion in response to cholate and diosgenin. PMID: 15611112
  37. MDR2 expression is required for ABCG5- and ABCG8-mediated biliary sterol secretion. Inactivation of MDR2 markedly attenuated the reduction in fractional sterol absorption associated with ABCG5, ABCG8 overexpression PMID: 15930516
  38. Strong relationship between ABCG5 and ABCG8 gene expression is consistent with the coordinate regulation of both genes and in line with heterodimerization of both proteins into a functional transporter. PMID: 16250035
  39. Two genes, ABCG5 and ABCG8, compose the sitosterolemia locus, and complete mutation in either, but not both, results in disease. PMID: 16472606
  40. In diabetic patients statin therapy is associated wiwth increased mRNA. PMID: 16518588
  41. ABCG5 polymorphism may play a role in the plasma response to dietary cholesterol and carotenoids. PMID: 16614398
  42. Purified ABCG5 and ABCG8 had very low ATPase activities, suggesting that the hetero-dimer is the catalytically active species, and likely the active species in vivo. PMID: 16893193
  43. Polymorphisms at the half-transporter ABCG5 and ABCG8 genes affect blood cholesterol concentrations in prepubertal children by influencing dietary responsiveness. PMID: 16980816
  44. biochemical and functional characterization of the ABCG5/ABCG8 proteins and their possible involvement in steroid hormone transport or regulation. PMID: 17055487
  45. Increased NPC1L1 and lower ABCG5 abd ABCG8 may lead to increased cholesterol and sitosterol in chylomicron particles in diabetic patients. PMID: 17102949
  46. Cooperative interaction between HNF4A and GATA4 and GATA6 regulates ABCG5 and ABCG8. PMID: 17403900
  47. results indicate that ABCG5/G8, unlike ABCA1, together with bile acids should participate in sterol efflux on the apical surface of Caco-2 cells. PMID: 17690481
  48. changes in cholesterol metabolism after weight loss were affected by single nucleotide polymorphisms (SNPs) in ABCG5 PMID: 17827468
  49. Upregulation of ABCG5/ABCG8 in gallstone patients, possibly mediated by increased liver X receptor (LXR) alpha, may contribute to the cholesterol supersaturation of bile, a prerequisite for gallstone formation. PMID: 18007013
  50. Carriers of ABCG5 604Q or ABCG8 D19H polymorphisms have an increased risk of gallstone disease independent of age, sex and body mass index. PMID: 18457353

Show More

Hide All

Database Links

HGNC: 13886

OMIM: 210250

KEGG: hsa:64240

STRING: 9606.ENSP00000260645

UniGene: Hs.132992

Involvement In Disease
Sitosterolemia (STSL)
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein.
Tissue Specificity
Strongly expressed in the liver, lower levels in the small intestine and colon.

Q&A

What is the basic structure and function of ATP-binding cassette sub-family G member 5 (ABCG5)?

ABCG5 is a member of the ATP-binding cassette (ABC) transporter superfamily. Structurally, it functions as a half-transporter consisting of a single ABC cassette in the amino terminal followed by six putative transmembrane domains. To become functionally active, ABCG5 forms an obligate heterodimer with ABCG8. This heterodimeric complex mediates Mg²⁺- and ATP-dependent sterol transport across cell membranes .

The primary function of the ABCG5/G8 complex is to:

  • Limit intestinal absorption of dietary plant sterols

  • Promote biliary excretion of sterols

  • Facilitate selective transport of cholesterol in/out of enterocytes

  • Maintain normal sterol homeostasis through selective sterol excretion by the liver into bile

Unlike some other ABCG family members such as ABCG2, ABCG5 is specifically involved in cholesterol efflux transport rather than xenobiotic transport .

How does recombinant ABCG5 differ from endogenous human ABCG5?

Recombinant ABCG5 is artificially produced through molecular cloning techniques, typically expressed in heterologous systems such as E. coli, mammalian cells, or insect cells. When properly engineered, recombinant ABCG5 maintains the structural and functional characteristics of endogenous ABCG5, but with several important distinctions:

CharacteristicEndogenous ABCG5Recombinant ABCG5
Expression contextTissue-specific (liver, colon, intestine)Expression system-dependent
Post-translational modificationsFully processedMay vary depending on expression system
HeterodimerizationNatural pairing with ABCG8May require co-expression with ABCG8
Molecular weight72.5 kDaMay include fusion tags or modifications
RegulationUnder physiological controlConstitutive or inducible expression

For research purposes, recombinant ABCG5 fragments are often used as immunogens for antibody production, as seen in the purified recombinant fragment (AA: 306-367) expressed in E. coli for antibody development .

What are the optimal expression systems for producing functional recombinant ABCG5?

The choice of expression system for recombinant ABCG5 significantly impacts protein yield, functionality, and downstream applications. The following table compares expression systems based on research outcomes:

Expression SystemAdvantagesLimitationsYieldFunctional Activity
E. coliHigh yield, rapid growth, economicalLimited post-translational modifications, inclusion body formationHigh for fragments, low for full-lengthFragments for antigen use only
Mammalian cells (HEK293, CHO)Proper folding, native post-translational modificationsSlower growth, higher cost, lower yieldModerateHigh (requires ABCG8 co-expression)
Insect cells (Sf9, High Five)Higher yield than mammalian, proper foldingModerate cost, differences in glycosylationModerate to highHigh (requires ABCG8 co-expression)
Cell-free systemsRapid, avoids cellular toxicityLimited post-translational modificationsLow to moderateLimited

For functional studies requiring membrane integration and ATPase activity, mammalian or insect cell expression systems co-expressing both ABCG5 and ABCG8 are recommended, as they allow for proper heterodimer formation essential for transport function .

How can researchers optimize the purification of recombinant ABCG5/G8 heterodimers while maintaining functional integrity?

Purifying functional ABCG5/G8 heterodimers presents significant challenges due to their membrane-bound nature and requirement for dimerization. A methodological approach includes:

  • Co-expression strategy: Simultaneous expression of both ABCG5 and ABCG8 in the same cells is critical for proper heterodimer formation

  • Membrane extraction:

    • Use mild detergents (DDM, LMNG, or GDN) that preserve protein-protein interactions

    • Maintain appropriate lipid-to-detergent ratios to preserve the native lipid environment

  • Affinity purification:

    • Incorporate differential tags (e.g., His-tag on ABCG5, FLAG-tag on ABCG8)

    • Use tandem affinity purification to ensure isolation of heterodimers only

    • Include ATP or non-hydrolyzable ATP analogs in buffers to stabilize the ABC domain

  • Quality control checkpoints:

    • Size exclusion chromatography to confirm heterodimer formation

    • ATPase activity assays to verify functional integrity

    • Lipid reconstitution to assess transport activity

The heterodimer with ABCG8 demonstrates ATPase activity that can serve as a functional verification metric during purification .

What experimental approaches can effectively measure ABCG5/G8 sterol transport activity in vitro?

Measuring ABCG5/G8-mediated sterol transport presents methodological challenges that require specialized assay systems:

Vesicle-Based Transport Assays:

  • Proteoliposome reconstitution:

    • Purified ABCG5/G8 heterodimers incorporated into liposomes

    • Inside-out or right-side-out orientation can be selectively generated

    • Fluorescently labeled sterols (NBD-cholesterol) or radiolabeled sterols (³H-cholesterol) as substrates

  • Measurement parameters:

    • ATP-dependent accumulation or efflux of labeled sterols

    • Kinetic parameters including Km and Vmax for different sterol substrates

    • Mg²⁺ dependence of transport activity

Cell-Based Transport Assays:

  • Polarized cell models:

    • Caco-2 or MDCK cells transfected with ABCG5/G8

    • Measurement of transcellular transport of sterols

    • Comparison between wildtype and mutant proteins

  • Quantification methods:

    • LC-MS/MS for precise sterol quantification

    • Fluorescence microscopy for localization and trafficking studies

These methodologies have revealed that the ABCG5/G8 heterodimer mediates ATP-dependent sterol transport with specificity for different sterol species, showing higher efficiency for plant sterols compared to cholesterol .

How do researchers analyze the ATPase activity of recombinant ABCG5/G8 complexes and correlate it with transport function?

The ATPase activity of ABCG5/G8 heterodimers serves as an essential functional readout and can be analyzed through several complementary approaches:

  • Colorimetric phosphate release assays:

    • Measures inorganic phosphate released during ATP hydrolysis

    • Can be performed using purified protein in detergent micelles or reconstituted proteoliposomes

    • Typically measures steady-state ATP hydrolysis rates

  • Coupled enzyme assays:

    • NADH-coupled spectrophotometric assay measuring ATP consumption

    • Provides real-time monitoring of ATPase activity

    • Useful for kinetic studies and inhibitor screening

  • Structure-function correlation:

    • Site-directed mutagenesis of conserved Walker A/B motifs and comparison of ATPase activities

    • Analysis of disease-associated mutations and their impact on ATPase function

    • Correlation between ATP hydrolysis rates and sterol transport activity

Research has demonstrated that the ATPase activity of ABCG5/G8 heterodimers is stimulated by specific sterol substrates, particularly plant sterols, suggesting a coupling mechanism between substrate binding and ATP hydrolysis that drives the transport cycle .

How do mutations in ABCG5 affect protein function and contribute to sitosterolemia?

Mutations in ABCG5 are causatively linked to sitosterolemia, a rare autosomal recessive disorder characterized by elevated plant sterol levels in plasma and tissues. The molecular mechanisms by which these mutations disrupt ABCG5 function have been extensively studied:

Mutation TypeEffect on ProteinFunctional ConsequenceClinical Manifestation
Missense mutationsAltered protein folding or substrate bindingReduced transport activityModerate to severe sitosterolemia
Nonsense mutationsTruncated proteinComplete loss of functionSevere sitosterolemia
Frameshift mutationsAltered reading frame, premature terminationComplete loss of functionSevere sitosterolemia
Splice site mutationsAberrant splicing, exon skippingVariable effects on protein functionVariable disease severity

Studies with recombinant ABCG5 containing disease-associated mutations have revealed several pathogenic mechanisms:

  • Trafficking defects: Mutations that prevent proper localization to the plasma membrane

  • Dimerization failures: Mutations that disrupt ABCG5/G8 heterodimer formation

  • ATPase dysfunction: Mutations in nucleotide-binding domains that impair ATP hydrolysis

  • Substrate recognition defects: Mutations that alter sterol binding sites

These mutations ultimately lead to impaired intestinal excretion of dietary plant sterols and reduced biliary sterol secretion, resulting in sterol accumulation and atherosclerosis .

What experimental approaches can distinguish between pathogenic and benign ABCG5 variants?

Distinguishing between pathogenic and benign ABCG5 variants requires a multi-tiered experimental approach that combines functional, structural, and clinical data:

  • In silico prediction tools:

    • Sequence conservation analysis across species

    • Structural modeling to predict impact on protein folding and function

    • Frequency in population databases versus disease cohorts

  • Cell-based functional assays:

    • Expression of variant ABCG5 with wildtype ABCG8 in heterologous systems

    • Assessment of protein expression, localization, and stability

    • Measurement of sterol transport activity using fluorescent or radiolabeled substrates

  • Biochemical characterization:

    • Purification of recombinant variant proteins

    • Analysis of heterodimer formation efficiency with ABCG8

    • Measurement of ATPase activity and comparison with wildtype protein

  • Genotype-phenotype correlation studies:

    • Analysis of clinical data from patients with specific variants

    • Plasma phytosterol levels in carriers versus non-carriers

    • Response to treatment in patients with different variants

These approaches have revealed that mutations affecting the conserved ATP-binding cassette or transmembrane domains typically have the most severe functional consequences, while variants in less conserved regions may represent benign polymorphisms or risk modifiers .

How can molecular dynamics simulations enhance our understanding of ABCG5/G8 transport mechanisms?

Molecular dynamics (MD) simulations provide powerful insights into the atomic-level mechanisms of ABCG5/G8 transport that are difficult to capture experimentally:

  • Transport cycle modeling:

    • Simulation of conformational changes during ATP binding, hydrolysis, and release

    • Identification of intermediate states in the transport cycle

    • Elucidation of the coupling mechanism between ATP hydrolysis and sterol movement

  • Substrate specificity determinants:

    • Computational docking of various sterol substrates

    • Analysis of binding free energies for different sterols

    • Identification of key residues that determine selectivity for plant sterols versus cholesterol

  • Water and ion pathways:

    • Tracking of water molecules during the transport cycle

    • Identification of conserved water-mediated hydrogen bond networks

    • Analysis of Mg²⁺ coordination during ATP hydrolysis

  • Membrane interactions:

    • Simulation of ABCG5/G8 in native-like lipid environments

    • Analysis of lipid-protein interactions that influence transporter function

    • Effects of membrane composition on transporter dynamics

Recent MD studies have suggested that ABCG5/G8 heterodimers undergo substantial conformational changes during the transport cycle, with ATP binding inducing closure of the nucleotide-binding domains and consequent rearrangement of the transmembrane domains to facilitate sterol movement across the membrane .

What are the latest approaches for studying ABCG5/G8 interactions with other proteins and cellular pathways?

Understanding ABCG5/G8 interactions with other proteins and cellular pathways requires advanced methodologies that capture physiological complexity:

  • Proximity-dependent labeling techniques:

    • BioID or TurboID fusion proteins to identify proximal interacting partners

    • APEX2-based proximity labeling in intact cellular membranes

    • Quantitative proteomics to identify condition-dependent interactions

  • Live-cell protein-protein interaction assays:

    • Split fluorescent/luminescent protein complementation assays

    • FRET/BRET-based interaction monitoring

    • Single-molecule tracking to capture transient interactions

  • Multi-omics approaches:

    • Integration of transcriptomics, proteomics, and lipidomics data

    • Network analysis to identify regulatory pathways

    • Correlation of ABCG5/G8 expression with global cellular responses

  • Genome-wide functional screens:

    • CRISPR-Cas9 screens to identify genes affecting ABCG5/G8 function

    • siRNA/shRNA screens for regulatory factors

    • Chemical genetics approaches to identify pathway modulators

Recent studies have revealed potential interactions between ABCG5/G8 and nuclear receptors like NR1H2 and NR1H3 (LXRα and LXRβ), suggesting complex regulatory mechanisms that coordinate sterol homeostasis across tissues .

What are common pitfalls in recombinant ABCG5 expression and how can they be overcome?

Researchers frequently encounter specific challenges when working with recombinant ABCG5, particularly due to its membrane protein nature and requirement for heterodimerization:

ChallengeUnderlying CausesSolution Strategies
Low expression levelsProtein toxicity, poor codon usage, inefficient transcriptionOptimize codon usage, use inducible promoters, lower expression temperature
Inclusion body formationMisfolding, hydrophobic aggregation, lack of chaperonesCo-express with molecular chaperones, use solubilization tags, optimize folding conditions
Improper membrane integrationInefficient targeting, hydrophobic mismatchUse appropriate signal sequences, optimize membrane composition
Inefficient heterodimerizationImbalanced expression of ABCG5 and ABCG8, improper foldingCo-express from bicistronic constructs, optimize stoichiometry
Poor stability during purificationDetergent-induced destabilization, loss of essential lipidsScreen detergents systematically, maintain critical lipids, add stabilizing agents

When working with antibodies against ABCG5, researchers should be aware of experimental conditions that affect epitope recognition. For example, when using the mouse monoclonal ABCG5 antibody targeting amino acids 306-367, optimal dilutions vary by application (ELISA: 1/10000, WB: 1/500-1/2000, IHC: 1/200-1/1000, FCM: 1/200-1/400) .

How do researchers resolve discrepancies between in vitro and in vivo findings regarding ABCG5 function?

Reconciling differences between in vitro biochemical data and in vivo physiological observations is a significant challenge in ABCG5 research:

  • Systematic comparison approaches:

    • Parallel studies in multiple model systems (cell lines, primary cells, organoids, animal models)

    • Correlation of biochemical parameters with physiological readouts

    • Scaling analyses to account for differences in protein expression and membrane composition

  • Advanced physiological models:

    • Intestinal organoids derived from patient samples or engineered stem cells

    • Liver-on-chip technology with polarized hepatocytes

    • Humanized animal models expressing human ABCG5/G8

  • Reconciliation strategies for conflicting data:

    • Identification of cell type-specific cofactors or regulators

    • Analysis of post-translational modifications present in vivo but absent in vitro

    • Consideration of compensatory mechanisms active in physiological settings

  • Integrated experimental design:

    • Development of assays that bridge in vitro and in vivo measurements

    • Traceable labeled sterols that can be followed from in vitro to in vivo systems

    • Mathematical modeling to reconcile kinetic differences

A notable example of in vitro/in vivo discrepancy involves the regulation of ABCG5/G8 by liver X receptors (LXRs). While in vitro studies often show direct and substantial regulation, in vivo effects can be more subtle and context-dependent, highlighting the complexity of sterol homeostasis regulation in physiological settings .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.