Recombinant Human ATP-binding cassette sub-family G member 8 (ABCG8)

Shipped with Ice Packs
In Stock

Description

Functional Role in Sterol Homeostasis

ABCG8 operates exclusively as a heterodimer with ABCG5 to:

  • Limit intestinal absorption of dietary sterols .

  • Promote biliary excretion of cholesterol and phytosterols .

  • Prevent sterol accumulation linked to atherosclerosis and sitosterolemia .

Mechanism: The ABCG5/ABCG8 complex utilizes ATP hydrolysis to transport sterols against concentration gradients. Mutations disrupting dimerization (e.g., R263Q, W361X) impair trafficking to the plasma membrane, causing intracellular retention and sterol dysregulation .

Applications in Research

Recombinant ABCG8 is widely used in:

3.1. Functional Studies

  • Sterol Transfer Assays: Demonstrates ATP-dependent cholesterol and sitosterol transport in reconstituted proteoliposomes .

  • Localization Studies: Coexpression with ABCG5 enables apical membrane targeting in polarized hepatocytes .

3.2. Disease Modeling

  • Sitosterolemia: Over 430 pathogenic variants in ABCG8 (e.g., rs11887534) correlate with hyperabsorption of plant sterols and xanthoma formation .

  • Gallstone Disease: Gain-of-function mutations increase biliary cholesterol secretion, predisposing to cholesterol gallstones .

3.3. Therapeutic Screening

Used to evaluate compounds targeting sterol-lowering pathways, including:

  • Small-molecule inhibitors of intestinal sterol uptake.

  • Agonists enhancing biliary sterol excretion .

4.2. Clinical Correlations

MutationPhenotypeFunctional Impact
R419H (ABCG5)Sitosterolemia with macrothrombocytopeniaDisrupted sterol efflux, platelet dysfunction
rs11887534Gallbladder disease (GBD4)Enhanced biliary cholesterol secretion

Future Directions

Current research focuses on:

  • Cryo-EM structures of the ABCG5/ABCG8 heterodimer to elucidate sterol-binding pockets.

  • Gene-editing therapies for sitosterolemia using CRISPR-Cas9 to correct ABCG8 mutations .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All protein shipments include standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your reconstitution.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize the development of your desired tag.
Synonyms
ABCG8; ATP-binding cassette sub-family G member 8; Sterolin-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-673
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MAGKAAEERGLPKGATPQDTSGLQDRLFSSESDNSLYFTYSGQPNTLEVRDLNYQVDLAS QVPWFEQLAQFKMPWTSPSCQNSCELGIQNLSFKVRSGQMLAIIGSSGCGRASLLDVITG RGHGGKIKSGQIWINGQPSSPQLVRKCVAHVRQHNQLLPNLTVRETLAFIAQMRLPRTFS QAQRDKRVEDVIAELRLRQCADTRVGNMYVRGLSGGERRRVSIGVQLLWNPGILILDEPT SGLDSFTAHNLVKTLSRLAKGNRLVLISLHQPRSDIFRLFDLVLLMTSGTPIYLGAAQHM VQYFTAIGYPCPRYSNPADFYVDLTSIDRRSREQELATREKAQSLAALFLEKVRDLDDFL WKAETKDLDEDTCVESSVTPLDTNCLPSPTKMPGAVQQFTTLIRRQISNDFRDLPTLLIH GAEACLMSMTIGFLYFGHGSIQLSFMDTAALLFMIGALIPFNVILDVISKCYSERAMLYY ELEDGLYTTGPYFFAKILGELPEHCAYIIIYGMPTYWLANLRPGLQPFLLHFLLVWLVVF CCRIMALAAAALLPTFHMASFFSNALYNSFYLAGGFMINLSSLWTVPAWISKVSFLRWCF EGLMKIQFSRRTYKMPLGNLTIAVSGDKILSVMELDSYPLYAIYLIVIGLSGGFMVLYYV SLRFIKQKPSQDW
Uniprot No.

Target Background

Function
ABCG5 and ABCG8 form an obligate heterodimer responsible for Mg(2+)- and ATP-dependent sterol transport across cell membranes. This complex plays a crucial role in the selective transport of dietary cholesterol into and out of enterocytes and in the selective sterol excretion from the liver into bile. It is essential for maintaining normal sterol homeostasis. The heterodimer with ABCG5 exhibits ATPase activity.
Gene References Into Functions
  1. We identified a novel mutation in the ABCG8 gene, which in the homozygous form was associated with generalized xanthomatosis, and in the heterozygous form was associated with isolated xanthelasmas. PMID: 28739549
  2. Case Reports: Compound heterozygosity for nonsense mutations in ABCG8 was found to be responsible for sitosterolemia. PMID: 28521186
  3. ABCG8 genetic variants may play a role in the development of cholelithiasis in patients with Gaucher disease type 1. PMID: 27981300
  4. Genetic polymorphism within the ABCG8 gene is identified as a risk factor for diabetes. PMID: 26088706
  5. A polymorphism of the sterol transporter ABCG8 has been associated with the prevalence of end-stage renal disease. PMID: 25804128
  6. Mutation in ABCG8 is associated with sitosterolaemia. PMID: 25056759
  7. A single nucleotide polymorphism of ABCG8 is associated with fasting plasma glucose levels in a cross-sectional study but does not predict hyperglycemia or incident type 2 diabetes. [meta-analysis] PMID: 23840693
  8. The evolutionary conserved region of ABCG8 was found to be responsive to the Liver-X-Receptor. PMID: 23790976
  9. Recurrence of gallstones after cholecystectomy is associated with ABCG8 genotype. PMID: 22869156
  10. ABCG8 (and ABO) variants are associated with high intestinal cholesterol absorption and cardiovascular disease. PMID: 23707316
  11. Both gallstone disease and p.D19H of ABCG8 are associated with diminished cholesterol absorption. PMID: 23406058
  12. ABCG8-D19H variant associated with cholesterol gallstone disease PMID: 22898925
  13. G574R variant is associated with moderately elevated plant sterol levels in Old Order Amish. Carriers of the 574R allele had modestly lower levels of carotid wall thickness compared with noncarriers. PMID: 23241408
  14. The ABCG8 rs4148217 SNP is associated with serum TG, HDL-C and ApoA1 levels in our study populations, but this association is different between the Mulao and Han populations. PMID: 22548731
  15. Data suggest that ABCG8 S107X heterozygous mutation affects plasma phytosterol levels but not cholesterol metabolism (i.e., intestinal absorption, biosynthesis). Mutation affects efficacy of phytosterols supplementation on cholesterol absorption. PMID: 22378727
  16. ABCG8 D19H genotype was an important predictor of both symptomatic gallstone disease and biliary cancer. PMID: 21274884
  17. In the present study, we observed a highly significant association of the ABCG8 DH genotype and H allele with gallstone susceptibility in the northern Indian population. PMID: 21039838
  18. Associations of 4 common ABCG8 polymorphisms (D19H, Y54C, T400K, and A632V)with ischemic stroke and coronary artery disease were sought. There was a tendency toward reduced 54YY-genotype frequency among male patients under 50 years of age with stroke. PMID: 20854103
  19. ABCG8 rs11887534, identified as a gallstone risk single-nucleotide polymorphism by whole genome scan, is also associated with an increased risk of biliary tract cancer. PMID: 21062971
  20. A systematic review and meta-analysis of ABCG8 polymorphisms and association with markers of cholesterol metabolism. PMID: 20581104
  21. Common variants in ABCG8 and ABO are strongly associated with serum phytosterol levels and show concordant and previously unknown associations with coronary heart disease. PMID: 20529992
  22. For the ABCG8 gene, the rs4148211 polymorphism was associated with higher plasma total cholesterol and LDLcholesterol concentrations in the total population. PMID: 20170916
  23. Genetic variant 19H of ABCG8 is associated with coronary artery disease. PMID: 20592455
  24. SNP D19H, but not SNP T400K, in the ABCG8 gene is significantly associated with GSD in an Indian population. PMID: 20594224
  25. Twins carrying a heterozygous or homozygous ABCG8 D19H genotype have a significantly increased risk of gallstone disease. PMID: 20497293
  26. strong association of sequence variants of HMGCR, SREBF1 and ABCG8 genes with the reduction of LDL-C after statin treatment in a Chinese population PMID: 20235787
  27. Common DNA sequence polymorphisms in the ABCG8 gene contribute to heritable variation in the plasma concentrations of the plant sterols campesterol and sitosterol. PMID: 11893785
  28. In a sitosterolemia patient a novel heterozygous mutation has been found in exon 5 of ABCG8 (c.584T>A; Leu195Gln). PMID: 12124998
  29. Genetic variations in the ABCG8 gene may play a role in the genetic determination of plasma cholesterol levels and could possibly influence the gender-specific response of plasma cholesterol levels after dietary changes. PMID: 15311998
  30. These findings indicate that the T400K polymorphism in ABCG8 may be associated with the incidence of gallstone disease in males. PMID: 17612515
  31. The results of the genetic study taken together indicate that in gallstone-susceptible carriers of the ABCG8 19H allele, cholesterol cholelithiasis is secondary to increased hepatobiliary cholesterol secretion. PMID: 17626266
  32. An association scan of >500,000 SNPs in individuals with gallstones and controls was performed; a follow-up study of the 235 most significant SNPs in affected individuals and controls replicated the disease association of SNP A-1791411 in ABCG8. PMID: 17632509
  33. Single nucleotide polymorphisms in ABCG8 are associated with changes in cholesterol metabolism during weight loss. PMID: 17827468
  34. Upregulation of ABCG5/ABCG8 in gallstone patients, possibly mediated by increased liver X receptor alpha, may contribute to the cholesterol supersaturation of bile, a prerequisite for gallstone formation. PMID: 18007013
  35. links between polymorphisms of ABC G8A (ABCG8) transporter gene to hypercholesterolemia and to gallstone disease risk (Review) PMID: 18522623
  36. Coexistence of higher insulin resistance and hypercholesterolemia for carriers of the aspartate-19-histidine polymorphism may result in a greater risk of cardiovascular disease. PMID: 18581044
  37. Genetic variation in the ABCG8 gene may influence the burden of atherosclerosis in familial hypercholesteremia. PMID: 18977479
  38. The DH genotype and the H allele of the ABCG8 D19H polymorphism are associated with Gallbladder cancer susceptibility. PMID: 19018975
  39. Insulin resistance elevates ABCG8 and increases susceptibility to cholesterol gallstones. PMID: 19306529

Show More

Hide All

Database Links

HGNC: 13887

OMIM: 210250

KEGG: hsa:64241

STRING: 9606.ENSP00000272286

UniGene: Hs.413931

Involvement In Disease
Gallbladder disease 4 (GBD4); Sitosterolemia (STSL)
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly expressed in the liver. Low expression levels in the small intestine and colon. Very low levels in other tissues, including brain, heart and spleen.

Q&A

What is the molecular function of ABCG8 in human physiology?

ABCG8 functions primarily as a membrane transporter that forms obligate heterodimers with ABCG5. This complex facilitates the efflux of plant sterols and cholesterol in hepatocytes and enterocytes. Specifically, ABCG8 plays a crucial role in limiting intestinal absorption and promoting biliary secretion of sterols, maintaining whole-body sterol homeostasis . The protein contains ATP-binding domains essential for its transport function and works through ATP-dependent mechanisms to regulate sterol movement across membranes.

How do mutations in ABCG8 contribute to sitosterolemia?

Pathogenic variants in ABCG8 disrupt normal sterol homeostasis, particularly affecting plant sterol metabolism. Patients with sitosterolemia have significantly elevated serum sitosterol levels (median 10.1 μg/mL in those with pathogenic variants vs. 3.5 μg/mL in those with benign variants) . The disease manifests due to increased intestinal absorption and decreased biliary excretion of plant sterols, resulting in accumulation in plasma and tissues. Various mutation types (missense, nonsense, frameshift, deletion, and splice mutations) have been identified, with c.1256T>A (p.Ile419Asn) being a common pathogenic variant in ABCG8 .

What experimental models are most suitable for studying ABCG8 function?

For ABCG8 research, multiple model systems offer complementary insights:

  • Cell-based models: HepG2 (liver) and Caco-2 (intestinal) cell lines are valuable for studying transport function

  • Animal models: ABCG8 knockout mice show phenotypes similar to human sitosterolemia

  • Yeast expression systems: Useful for high-throughput variant analysis

  • Reconstituted liposomes: Allow for detailed mechanistic studies of transport kinetics

Selection should be based on specific research questions; membrane protein studies often require multiple model systems to establish consistent findings.

What are the optimal expression systems for producing recombinant human ABCG8?

For recombinant ABCG8 production, consider these expression systems, each with distinct advantages:

Expression SystemAdvantagesLimitationsYieldPurification Approach
HEK293 cellsNative glycosylation, proper foldingLower yield0.5-2 mg/LAffinity chromatography
Sf9 insect cellsHigher yield, post-translational modificationsAltered glycosylation2-5 mg/LTwo-step chromatography
Pichia pastorisCost-effective, high density cultureGlycosylation differences3-10 mg/LDetergent extraction
E. coliRapid, economicalLacks post-translational modificationsVariableInclusion body refolding

Note that ABCG8 expression typically requires co-expression with ABCG5 for proper folding and function. The HEK293 and Sf9 systems generally produce the most functionally active protein despite lower yields .

How can researchers effectively assess ABCG8 transport activity in vitro?

Transport activity assessment for ABCG8 requires specialized techniques:

  • Vesicular transport assays: Measure ATP-dependent substrate transport using inside-out membrane vesicles from cells expressing ABCG8/G5

  • Fluorescent substrate trafficking: Track movement of labeled sterols (e.g., NBD-cholesterol) in living cells

  • ATPase assays: Quantify ATP hydrolysis rates as an indirect measure of transport activity

  • Radioactive substrate flux: Measure movement of labeled sterols across cell monolayers

Control experiments must account for endogenous transporter activity, ATP-independent passive diffusion, and potential substrate binding to membranes. Validation using multiple substrates (cholesterol, plant sterols) is recommended for comprehensive functional characterization .

What strategies should be employed to study ABCG8-ABCG5 heterodimer formation?

Investigating ABCG8-ABCG5 heterodimer formation requires techniques that preserve the native protein-protein interaction:

  • Co-immunoprecipitation: Use antibodies against one protein to precipitate the complex

  • FRET/BRET analysis: Tag proteins with fluorescent/bioluminescent markers to measure interaction distances

  • Crosslinking studies: Employ chemical crosslinkers followed by mass spectrometry

  • Blue native PAGE: Separate intact protein complexes under non-denaturing conditions

When designing these experiments, researchers should consider using:

  • Dual affinity tags (e.g., His-tag on ABCG8, FLAG-tag on ABCG5)

  • Mild detergents that preserve membrane protein interactions

  • Controls that can detect non-specific interactions

All approaches should include appropriate negative controls using known non-interacting proteins .

How can researchers distinguish pathogenic from benign variants in ABCG8?

A systematic approach to variant pathogenicity assessment includes multiple layers of evidence:

  • Clinical correlation: Pathogenic ABCG8 variants correlate with serum sitosterol levels ≥10 μg/mL, while benign variants show levels around 3.5 μg/mL

  • Population frequency analysis: Pathogenic variants are typically rare in population databases

  • In silico prediction tools: Use SIFT, PolyPhen-2, and CADD scores

  • Functional assays: Measure transport activity of variant proteins

  • Structural analysis: Evaluate the variant's position in protein structure

A comprehensive classification scheme should integrate:

  • Biochemical phenotypes (sitosterol levels)

  • Segregation in families

  • Conservation of the affected residue

  • Functional impacts from in vitro studies

What statistical approaches are appropriate for analyzing ABCG8 variant data?

Statistical analysis of ABCG8 variant data requires careful consideration:

  • For continuous variables: Use Student's t-test for normally distributed data (e.g., cholesterol levels) and non-parametric Wilcoxon-Mann-Whitney test for non-normally distributed data (e.g., sitosterol levels)

  • For categorical data: Apply chi-square tests to compare variant frequencies

  • For genotype-phenotype correlations: Implement regression analysis adjusting for confounding factors like age, sex, and medication use

  • For rare variant analysis: Consider burden tests or sequence kernel association tests

  • Sample size considerations: Power calculations based on expected effect sizes

Statistical significance thresholds should account for multiple testing (e.g., p < 0.05 for hypothesis-driven tests, stricter thresholds for exploratory analyses) .

How should researchers address confounding factors in ABCG8 functional studies?

Several confounding factors can impact ABCG8 research results:

  • Medication effects: Lipid-lowering medications (particularly statins and ezetimibe) alter sterol levels; document patient medication status and consider washout periods

  • Diet influence: Dietary plant sterol intake affects measurements; standardize or document dietary intake

  • Age and sex variations: Age and sex affect sterol metabolism; stratify analysis accordingly

  • Endogenous expression: Cell lines may express varying levels of endogenous ABC transporters; use appropriate knockdown/knockout controls

  • Heterodimer requirements: ABCG8 function depends on ABCG5 presence; ensure co-expression in systems

Researchers should implement the following controls:

  • Include positive (known functional) and negative (known non-functional) variant controls

  • Use empty vector transfections

  • Quantify protein expression levels when comparing variant functions

How do ABCG8 polymorphisms interact with dietary factors to influence cardiovascular risk?

ABCG8 polymorphisms modulate the relationship between dietary sterol intake and cardiovascular outcomes through several mechanisms:

  • Sterol absorption efficiency: Variants affect the percentage of dietary sterols absorbed

  • Response to plant sterol therapy: Polymorphisms predict responsiveness to plant sterol supplementation

  • Interaction with dietary fat: Some variants show stronger phenotypic effects with high-fat diets

Research approaches should include:

  • Dietary intervention studies with genotype stratification

  • Lipidomic profiling to capture broader metabolic effects

  • Assessment of interaction terms in statistical models

  • Consideration of gene-gene interactions, particularly with other sterol-related genes

This research area requires multidisciplinary approaches combining nutritional science, genetics, and cardiovascular medicine .

What structural features of ABCG8 determine substrate specificity?

The molecular determinants of ABCG8 substrate selectivity involve specific structural elements:

  • Transmembrane domains: Form the substrate-binding pocket with specific residues contacting sterols

  • Extracellular loops: May contribute to initial substrate recognition

  • ATP-binding domains: Control conformational changes during transport cycle

  • Interface with ABCG5: Creates a composite binding site with shared recognition elements

Research approaches to investigate these features include:

  • Cysteine-scanning mutagenesis followed by accessibility studies

  • Molecular dynamics simulations of sterol binding

  • Chimeric constructs swapping domains between related transporters

  • Directed evolution approaches to alter specificity

Understanding these structural determinants could enable engineering transporters with modified specificity for biotechnological applications .

How does post-translational regulation impact ABCG8 function in different tissues?

ABCG8 activity is modulated by multiple post-translational mechanisms that vary across tissues:

  • Phosphorylation: Kinase-dependent regulation affects transport kinetics

  • Glycosylation: Influences protein stability and trafficking

  • Ubiquitination: Controls protein turnover and surface expression

  • Membrane microdomain localization: Lipid raft association affects activity

Tissue-specific differences include:

  • Liver: Primary regulation through transcriptional mechanisms

  • Intestine: More responsive to acute post-translational modification

  • Gallbladder: Unique regulatory mechanisms affecting biliary secretion

Research strategies should employ tissue-specific models with inhibitors of specific modifications, mass spectrometry to identify modification sites, and sophisticated imaging to track protein localization and dynamics .

What are the major technical challenges in purifying functional ABCG8 protein?

Recombinant ABCG8 purification faces several technical hurdles:

ChallengeSolution StrategiesMonitoring Methods
Low expression yieldOptimize codon usage, use strong inducible promotersWestern blot quantification
Protein aggregationScreen detergents systematically, add stabilizing lipidsSize-exclusion chromatography
Loss of ABCG5 interactionCo-expression strategies, tandem purificationCo-immunoprecipitation
Incomplete ATP bindingInclude ATP/ATP-analogs during purificationATP binding assays
Function loss during purificationReconstitute into nanodiscs or liposomes quicklyTransport activity assays

Most successful purification protocols employ:

  • Mild solubilization conditions (detergent screening critical)

  • Affinity chromatography with elution at physiological pH

  • Size exclusion chromatography to remove aggregates

  • Immediate reconstitution into membrane-mimetic environments

How can researchers overcome variability in ABCG8 functional assays?

Reducing variability in ABCG8 functional measurements requires systematic approaches:

  • Standardize expression levels: Use inducible expression systems and quantify protein amounts

  • Control for heterodimer formation: Assess ABCG5-G8 complex formation in each experiment

  • Normalize transport data: Account for differences in expression level and membrane incorporation

  • Establish internal standards: Include reference compounds with known transport rates

  • Technical replicates: Perform at least three independent experiments with different protein preparations

The most reliable results typically combine multiple orthogonal assays:

  • Direct transport measurements

  • ATPase activity

  • Conformational change assays

  • Cell-based phenotypic rescue experiments

Data reporting should include full experimental details to facilitate reproduction by other researchers .

What strategies address the challenges of studying ABCG8 in primary human tissues?

Working with ABCG8 in primary human tissues presents unique difficulties:

  • Tissue access limitations: Establish collaborations with surgical departments for fresh samples

  • RNA/protein degradation: Develop rapid processing protocols (< 30 minutes from excision)

  • Low endogenous expression: Employ sensitive detection methods (droplet digital PCR, proximity ligation assays)

  • Heterogeneous cell populations: Use laser capture microdissection or single-cell approaches

  • Inter-individual variability: Increase sample sizes and document patient characteristics

Researchers have successfully addressed these challenges through:

  • Organoid cultures from primary tissues

  • Humanized mouse models expressing human ABCG8

  • Correlation of ex vivo measurements with clinical parameters

  • Integration of data from primary tissues with results from model systems

These approaches help bridge the gap between basic research and clinical relevance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.