Recombinant Human ATP-sensitive inward rectifier potassium channel 10 (KCNJ10)

Shipped with Ice Packs
In Stock

Description

Functional Insights

Recombinant KCNJ10 channels exhibit:

  • Inward Rectification: Preferential K⁺ influx, regulated by extracellular K⁺ and blocked by Mg²⁺, Ba²⁺, or Cs⁺ .

  • pH Sensitivity: Activity increases under alkaline conditions (e.g., R65P mutation shifts pH activation) .

  • Physiological Roles:

    • Neurological: Potassium buffering in glial cells to maintain neuronal excitability .

    • Renal: Basolateral K⁺ recycling in distal tubules, critical for Na⁺ reabsorption via Na⁺/K⁺-ATPase coupling .

    • Auditory: Endolymph production in the inner ear’s stria vascularis .

Table 2: Pathogenic Mutations in KCNJ10

MutationFunctional EffectClinical PhenotypeSource
R65PReduced pH sensitivity, impaired K⁺ fluxEAST syndrome (epilepsy, ataxia)
R175QChannel trafficking defectsAutism-epilepsy comorbidity
R199XComplete loss of functionSevere renal tubulopathy
  • EAST Syndrome: Autosomal recessive disorder caused by loss-of-function mutations (e.g., G77R, R199X), leading to epilepsy, ataxia, deafness, and renal salt wasting .

  • Gain-of-Function Mutations: Linked to autism spectrum disorders and epileptic spasms with favorable seizure prognosis .

Research Applications of Recombinant KCNJ10

  • Electrophysiology: Used in Xenopus oocytes or HEK293 cells to characterize ion selectivity and gating mechanisms .

  • Structural Studies: Crystallization of pore domains to investigate blocker binding (e.g., barium) .

  • Disease Modeling: Expression of mutant variants (e.g., R65P) to replicate EAST syndrome phenotypes in vitro .

Table 3: Available Recombinant KCNJ10 Proteins

SupplierCatalog NumberExpression SystemRegion ExpressedApplications
CusabioCF012048HUHEK293Full-lengthWB, functional assays
Abcamab114456Wheat germ276–379 aaELISA, SDS-PAGE
GeneBioSystemsN/AE. coliExtracellular domainBlockade studies

Key Research Findings

  • Renal Dysfunction: KCNJ10 knockout mice show collapsed distal tubule basolateral infoldings, impairing Na⁺ reabsorption .

  • Neuronal Hyperexcitability: Kir4.1 loss in glia disrupts K⁺ buffering, increasing seizure susceptibility .

  • Hearing Loss: KCNJ10−/− mice lack endocochlear potential, causing deafness due to reduced endolymph .

Clinical Implications

  • Therapeutic Targets: Modulating Kir4.1 pH sensitivity or expression may alleviate EAST syndrome symptoms .

  • Biomarker Potential: Kir4.1 autoantibodies are under investigation for autoimmune epilepsy .

Product Specs

Buffer
For liquid delivery, the protein is stored in a Tris/PBS-based buffer containing 5%-50% glycerol. Note: Specify your desired glycerol concentration in order comments if different from the default.
Description

Recombinant Human KCNJ10 protein is a full-length protein expressed in vitro using a cell-free E. coli system. Cell-free expression utilizes cell extracts containing all necessary components for transcription, translation, and post-translational modification. Supplementing with cofactors allows for rapid KCNJ10 protein synthesis within hours. While convenient for smaller-scale experiments, this method is not ideal for large-scale production. Key advantages include protein synthesis without cell culturing and the ability to co-express multiple proteins.

KCNJ10 is predominantly expressed in glial cells of the brain, inner ear, and kidney. In glial cells, KCNJ10 channels are crucial for extracellular potassium buffering, glutamate uptake, astrocyte development, and myelination. Within the inner ear, it regulates potassium homeostasis, contributing to endocochlear potential generation and maintenance—essential for hearing and cochlear development. In the kidney's distal convoluted tubules (DCTs), KCNJ10 facilitates potassium recycling and the establishment of a negative membrane potential. Autosomal recessive KCNJ10 gene mutations cause SeSAME/EAST syndrome, a multisystemic disorder.

Form
Liquid or Lyophilized powder. Note: While we prioritize shipping the available format, please specify your preferred format in your order comments to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
N-terminal 6xHis-SUMO-tagged
Synonyms
KCNJ10; ATP-sensitive inward rectifier potassium channel 10; ATP-dependent inwardly rectifying potassium channel Kir4.1; Inward rectifier K(+ channel Kir1.2; Potassium channel, inwardly rectifying subfamily J member 10
Datasheet & Coa
Please contact us to get it.
Expression Region
1-379aa
Mol. Weight
58.5kDa
Protein Length
Full Length
Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Neuroscience
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
KCNJ10
Target Protein Sequence
MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function

KCNJ10, also known as Kir4.1, likely plays a key role in potassium buffering by glial cells in the brain. Inward rectifier potassium channels (like Kir4.1) exhibit a preference for potassium influx. Their voltage dependence is influenced by extracellular potassium concentration; increased extracellular potassium shifts the voltage range of channel opening to more positive potentials. Inward rectification is primarily due to magnesium blockage of outward currents. Extracellular barium and cesium can block Kir4.1 channels. In the kidney, KCNJ10, in collaboration with KCNJ16, mediates basolateral potassium recycling in distal tubules, a critical process for sodium reabsorption.

Gene References Into Functions
  1. Glia-neuron interactions in the lateral habenula (LHb) involving Kir4.1 influence neuronal firing patterns, suggesting potential therapeutic targets for depression. PMID: 29446379
  2. A novel KCNJ10 mutation (L218F) and a known KCNT1 mutation were identified in a patient with seizures and neurodevelopmental delay. The KCNJ10 mutation reduced Kir current. PMID: 28747464
  3. Several SNPs (rs17375748, rs1130183, rs12133079, and rs1186688) in KCNJ10 have been associated with sudden infant death syndrome. PMID: 28520217
  4. KCNJ10 is involved in basolateral potassium recycling in renal nephron segments and in generating negative membrane potential. PMID: 27122539
  5. Research indicates that Kir4.1 protein autoantibodies are not specific to multiple sclerosis as initially thought. PMID: 27074083
  6. This study identified potential KCNJ10 SNPs that may contribute to seizure susceptibility and anti-epileptic drug resistance. PMID: 25874548
  7. Caveolin-1 disruption reduces basolateral potassium channel activity and depolarizes the DCT1 cell membrane, partially by suppressing c-Src's stimulatory effect on KCNJ10. PMID: 25848073
  8. Anti-KIR4.1 antibody levels vary in multiple sclerosis patients during relapse and remission, potentially serving as a disease exacerbation marker. PMID: 25392324
  9. This study showed an association between KCNJ10 rs2486253 polymorphism and childhood idiopathic generalized epilepsy. PMID: 25008907
  10. A lower prevalence of anti-Kir4.1 antibodies than previously reported was found in multiple sclerosis patients. PMID: 24756568
  11. KCNJ10 SNPs were not associated with nonsyndromic enlarged vestibular aqueduct in a Chinese patient cohort. PMID: 25372295
  12. No KIR4.1-specific antigen was detected in serum or cerebrospinal fluid of multiple sclerosis patients. PMID: 25008548
  13. In chronic inactive and remyelinating multiple sclerosis lesions, Kir4.1 immunoreactivity was restored on astrocytes and observed in some new myelinating oligodendrocytes. PMID: 24777949
  14. This study elucidated the pathophysiology of the p.A167V KCNJ10 mutation and demonstrated functional cooperation between KCNJ10 and KCNJ16. PMID: 24193250
  15. Kir4.1 channel mislocalization contributes to renal salt wasting. PMID: 24561201
  16. KCNJ10 rs1130183 was not associated with seizure susceptibility. PMID: 24378235
  17. EAST syndrome can result from various KCNJ10 mutations that significantly reduce potassium conductance. PMID: 21849804
  18. Ordered disorder of the astrocytic dystrophin-associated protein complex in health and disease. PMID: 24014171
  19. Serum antibodies to KIR4.1 are present in most children with acquired demyelinating disease, but not in healthy controls or children with other diseases. PMID: 24415573
  20. Tyrosine phosphorylation of KCNJ10 modulates membrane transport function in DCT1. PMID: 23873931
  21. No significant association was found between KCNJ10 and FOXI1 mutations and SLC26A4 in Pendred syndrome/enlarged vestibular aqueducts. PMID: 23965030
  22. Altered Kir4.1 expression in epilepsy-associated lesions is potentially influenced by the inflammatory environment, especially interleukin-1β. PMID: 23270518
  23. Postnatal upregulation of Kir4.1 potassium channels contributes to oligodendrocyte precursor cell development. PMID: 23392672
  24. The subcellular co-localization of Kir4.1 and AQP4 in cochlear supporting cells resembles that in central nervous system astroglia and retinal Müller cells. PMID: 22802001
  25. Loss of perivascular Kir4.1 potassium channels is observed in the sclerotic hippocampus of patients with mesial temporal lobe epilepsy. PMID: 22878665
  26. No KCNJ10 mutations were found in bilateral deafness patients with inner ear malformations. PMID: 22412181
  27. Kir4.1 channel downregulation worsens visual impairment caused by initial photoreceptor degeneration. PMID: 22055109
  28. Kir4.1 gain-of-function defects impair astrocytic potassium buffering, potentially contributing to autism/epilepsy phenotypes by altering neuronal excitability and synaptic function. PMID: 21458570
  29. Compromised potassium spatial buffering in the brain is implicated in the epilepsy phenotype associated with human KCNJ10 mutations. PMID: 21748805
  30. KCNJ10 function is relevant to proximal and distal retinal physiology. KCNJ10 mutations impact electroretinograms in EAST syndrome patients. PMID: 21300747
  31. KCNJ10 mutations cause EAST syndrome, characterized by epilepsy, ataxia, sensorineural deafness, and salt-wasting tubulopathy. PMID: 21221631
  32. No major association was found between KCNJ10 gene SNPs and schizophrenia in a Han Chinese population. PMID: 20933057
  33. The calcium-sensing receptor reduces Kir4.1 channel cell surface expression via a Gαq and caveolin-dependent mechanism. PMID: 21084311
  34. Perturbed pH gating may underlie the loss of function in disease-associated Kir4.1 mutants. PMID: 21088294
  35. Kir4.1 channel transgene influences glial cell membrane potential and potassium permeability in Kir4.1 knockout mice. PMID: 21106816
  36. SLC26A4, FOXI1, and KCNJ10 are not major factors in unilateral deafness and enlarged vestibular aqueduct. PMID: 20621367
  37. KCNJ10 mutations (R65P, G77R, and R175Q) significantly impaired channel function when expressed in CHO and HEK293 cells. PMID: 20651251
  38. Variations in the AQP4 and KCNJ10/KCNJ9 regions may be associated with temporal lobe epilepsy. PMID: 19864112
  39. Molecular analysis of chromosome 1q as a candidate gene for Type 2 diabetes in Pima Indians. PMID: 12401729
  40. The Arg271Cys missense variation in KCNJ10 (or a nearby variation) may be related to general seizure susceptibility. PMID: 15120748
  41. The common KCNJ10 Arg271Cys missense variation influences seizure susceptibility of idiopathic generalized epilepsy syndromes. PMID: 15725393
  42. The calcium-sensing receptor interacts directly with Kir4.1 and Kir4.2 and can reduce their currents. PMID: 17122384
  43. Kir 4.1 mRNA and protein expression, and immunoreactivity scores, increase with increasing pathological grade. PMID: 18191638
  44. KCNJ10 mutations on both alleles were identified in individuals affected by EAST syndrome, highlighting the importance of basolateral potassium channels in renal electrolyte homeostasis. PMID: 19289823
  45. KCNJ10 plays a crucial role in renal salt handling, and possibly blood pressure regulation. PMID: 19420365
  46. KCNJ10 mutations are associated with nonsyndromic hearing loss in carriers of SLC26A4 mutations with an enlarged vestibular aqueduct/Pendred syndrome phenotype. PMID: 19426954
Database Links

HGNC: 6256

OMIM: 602208

KEGG: hsa:3766

STRING: 9606.ENSP00000357068

UniGene: Hs.408960

Involvement In Disease
Seizures, sensorineural deafness, ataxia, mental retardation, and electrolyte imbalance (SESAMES)
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ10 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Basolateral cell membrane.
Tissue Specificity
Expressed in kidney (at protein level).

Q&A

What is KCNJ10 and what are its alternative names in scientific literature?

KCNJ10 (Potassium Inwardly Rectifying Channel Subfamily J Member 10) is a protein-coding gene that produces an inward rectifier-type potassium channel. In scientific literature, it is also known by several alternative names including Kir4.1, Kir1.2, ATP-Dependent Inwardly Rectifying Potassium Channel Kir4.1, and ATP-Sensitive Inward Rectifier Potassium Channel 10 . When referencing this channel in publications, it is advisable to include the primary name (KCNJ10) along with the most commonly recognized alternative (Kir4.1) to ensure clarity across different research fields where nomenclature may vary.

What are the basic functional characteristics of KCNJ10 channels?

KCNJ10 channels exhibit several distinctive functional characteristics that define their physiological roles. Most notably, these channels demonstrate inward rectification, characterized by a greater tendency to allow potassium ions to flow into the cell rather than out of it . Their voltage dependence is regulated by extracellular potassium concentration; as external potassium increases, the voltage range for channel opening shifts toward more positive voltages . The mechanism of inward rectification primarily involves blockage of outward current by internal magnesium ions . Additionally, KCNJ10 channels can be pharmacologically blocked by extracellular barium and cesium . These channels may form heterodimers with other potassium channel proteins, enhancing their functional diversity in different tissues.

In which tissues is KCNJ10 predominantly expressed and what are its primary functions?

KCNJ10 is predominantly expressed in glial cells in the brain, where it is responsible for potassium buffering action, helping to maintain appropriate extracellular potassium levels during neuronal activity . This function is critical for proper neuronal excitability and prevention of seizure activity. In the kidney, KCNJ10 works together with KCNJ16 to mediate basolateral potassium recycling in distal tubules, a process that is essential for sodium reabsorption . The channel is also expressed in the inner ear, where it contributes to the maintenance of endocochlear potential. The diverse tissue expression pattern explains why mutations in KCNJ10 can lead to multisystem disorders affecting neurological function, kidney function, and hearing.

What electrophysiological techniques are most appropriate for studying KCNJ10 channel function?

For studying KCNJ10 channel function, whole-cell patch-clamp recording represents the gold standard approach. Based on established protocols, researchers should use an extracellular solution containing (in mM): 140 NaCl, 5.4 KCl, 2.5 CaCl2, 0.53 MgCl2, 5.5 glucose, and 5.5 HEPES-KOH (pH 7.4), paired with an intracellular solution containing (in mM): 140 KCl, 5 K2ATP, 1 MgCl2, 5 EGTA, and 5 HEPES-KOH (pH 7.3) . Currents should be recorded using voltage steps from -120 to +40 mV in 10-mV increments, with a holding potential of 0 mV . For analysis, steady-state currents should be measured at the end of 300 ms during voltage step-pulses. This approach allows for detailed characterization of channel kinetics, rectification properties, and responses to pharmacological agents.

How can researchers effectively clone and express recombinant KCNJ10 for functional studies?

To clone and express recombinant KCNJ10, researchers should first obtain human KCNJ10 cDNA and clone it into an appropriate expression vector. A recommended approach is to fuse the construct with a human influenza hemagglutinin (HA) tag on its N-terminus and insert it into a vector containing a strong promoter, such as the pCDH-CMV-MCS-EF1-copGFP vector . For introducing specific mutations to study their effects, a mutagenesis kit like the KOD-plus-mutagenesis kit can be employed . The integrity of all constructs should be verified by Sanger sequencing. For expression, transfect the plasmids into appropriate cell lines such as HEK293T cells when they reach approximately 70% confluence, using 6 μg of plasmid DNA per 60 mm dish . This system allows for reliable expression and subsequent functional or biochemical analysis of wild-type and mutant KCNJ10 channels.

What methods are available for quantifying KCNJ10 protein expression at the cell surface?

Cell surface protein biotinylation represents an effective method for quantifying KCNJ10 expression at the plasma membrane. The protocol involves transfecting cells (such as 293T cells) with wild-type or mutant KCNJ10 plasmids, then incubating them with Sulfo-NHS-LC-biotin (0.5 mg/ml) at 4°C for 20 minutes . After quenching the reaction, cells should be lysed, and the protein supernatant collected and incubated with immobilized streptavidin agarose overnight at 4°C . Biotinylated proteins can then be eluted with sample buffer and analyzed by SDS-PAGE followed by western blotting with appropriate antibodies. This technique specifically labels and isolates proteins present at the cell surface, allowing researchers to distinguish between total KCNJ10 expression and the functionally relevant fraction that reaches the plasma membrane.

What diseases are associated with KCNJ10 mutations and what is the spectrum of phenotypes?

KCNJ10 mutations are associated with a range of disorders, most notably SeSAME/EAST syndrome, characterized by Seizures, Sensorineural deafness, Ataxia, Mental retardation (Impaired intellectual development), and Electrolyte imbalance . Another associated condition is Deafness, Autosomal Recessive 4, with Enlarged Vestibular Aqueduct . The phenotypic spectrum can vary considerably, from isolated seizure disorders to multi-system involvement. Most cases follow an autosomal recessive inheritance pattern requiring homozygous or compound heterozygous mutations, but there are reports of heterozygous mutations causing disease when co-occurring with mutations in other genes . In one documented case, a heterozygous KCNJ10 mutation combined with a KCNT1 mutation resulted in a particularly severe phenotype with profound developmental delay, failure to thrive, ataxia, hypotonia, and lethal tonic-clonic seizures .

How can researchers predict the functional impact of novel KCNJ10 mutations?

Predicting the functional impact of novel KCNJ10 mutations involves a multi-tiered approach. Initially, researchers should employ bioinformatic tools including PolyPhen-2, PROVEAN, SIFT, and MutationTaster to assess the potential pathogenicity of the mutations . The conservation of the affected amino acid residues should be evaluated using multiple sequence alignment tools such as Clustal Omega . Following computational analysis, experimental validation is essential. This should include electrophysiological studies comparing wild-type and mutant channels to assess changes in current density, kinetics, or rectification properties. Cell surface expression studies using biotinylation can determine if trafficking defects are present. Additionally, RT-PCR analysis can evaluate if the mutation affects mRNA expression levels . This comprehensive approach provides a robust assessment of mutation effects on channel function.

What are the mechanistic differences between KCNJ10 mutations causing SeSAME/EAST syndrome versus those associated with epilepsy?

KCNJ10 mutations causing SeSAME/EAST syndrome typically result in complete or near-complete loss of channel function, affecting multiple tissues where the channel is expressed. These mutations often impair trafficking to the cell membrane, alter pore properties, or severely disrupt channel gating . In contrast, mutations associated with isolated epilepsy or increased seizure susceptibility generally cause partial loss of function or altered regulation that primarily affects neuronal excitability without significantly disrupting function in other tissues . The distinction lies in the degree of functional impairment and tissue-specific effects. Some mutations in the C-terminal cytoplasmic domain (such as p.A201T and p.I209T) have been linked to SeSAME/EAST syndrome by affecting channel trafficking to the membrane . Research suggests that even heterozygous mutations can contribute to disease when combined with mutations in other channels, as demonstrated by the lethal phenotype observed in a patient with co-occurring mutations in KCNJ10 and KCNT1 .

How can KCNJ10 expression be accurately quantified at the mRNA level in experimental models?

For accurate quantification of KCNJ10 expression at the mRNA level, quantitative reverse transcription PCR (RT-qPCR) represents the method of choice. Total mRNA should be extracted using TRIzol reagent according to the manufacturer's protocol and reverse transcribed to cDNA using a high-quality reverse transcription kit . For KCNJ10 with an HA tag, primer design should incorporate the tag sequence (forward primer: 5′-CTGAAAAGCTCAAGTTGGAGGA-3′, reverse primer: 5′-GTAATCTGGAACATCGTATGGGTAG-3′) . For normalization, β-actin serves as an appropriate reference gene (primers: forward 5′-TGACGTGGACATCCGCAAAG-3′, reverse 5′-CTGGAAGGTGGACAGCGAGG-3′) . All samples should be assayed in triplicate using optical 96-well reaction plates with a real-time PCR system such as the LightCycler 480. Data analysis should be performed using the comparative Ct method, with results expressed as the ratio of KCNJ10 mRNA to β-actin mRNA. This approach ensures reproducible and reliable quantification across experimental conditions.

What approaches can be used to study the interaction between KCNJ10 and KCNJ16 in kidney function?

To study the interaction between KCNJ10 and KCNJ16 in kidney function, researchers should employ a multidisciplinary approach combining molecular, cellular, and physiological techniques. Co-immunoprecipitation can determine physical interaction between the two channel proteins in kidney tissue or cell models. Proximity ligation assays provide spatial resolution of protein interactions in situ. For functional studies, patch-clamp analysis of cells co-expressing both channels compared to cells expressing either channel alone can reveal how heteromerization affects channel properties. In vivo studies using kidney-specific conditional knockout models for either or both genes can assess their individual and combined roles in renal function. Measuring electrolyte balance, particularly potassium and sodium levels in blood and urine, in these models is essential as KCNJ10 and KCNJ16 together mediate basolateral potassium recycling in distal tubules, a process critical for sodium reabsorption . This combination of approaches provides comprehensive insights into how these channels cooperate in maintaining renal function.

How does the inward rectification property of KCNJ10 influence its physiological function?

The inward rectification property of KCNJ10 fundamentally influences its physiological function by allowing preferential inward flow of potassium ions while limiting outward current. This rectification is primarily due to voltage-dependent block by intracellular magnesium ions . Physiologically, this property is critical in glial cells where KCNJ10 contributes to spatial potassium buffering. During neuronal activity, localized increases in extracellular potassium occur; KCNJ10 channels in nearby glial cells allow potassium uptake while minimizing potassium efflux in areas with lower extracellular potassium, effectively redistributing potassium and preventing excessive neuronal excitability. The voltage dependence of KCNJ10 is regulated by extracellular potassium concentration, with channel opening shifting to more positive voltages as external potassium increases . This creates a self-regulating system where elevated extracellular potassium enhances the channel's ability to buffer potassium levels. Understanding this property is essential for interpreting how mutations that alter rectification characteristics may lead to neurological disorders such as epilepsy.

What are the available methods for detecting KCNJ10 protein in biological samples?

Several methods are available for detecting KCNJ10 protein in biological samples, each with specific advantages depending on research objectives. Commercially available sandwich ELISA kits offer quantitative detection of KCNJ10 in serum, plasma, urine, tissue homogenates, and cell culture supernatants with detection ranges of 62.5-2000 pg/ml and sensitivity of approximately 7 pg/ml . Western blotting using specific antibodies against KCNJ10 allows for semi-quantitative analysis and detection of post-translational modifications. Immunohistochemistry and immunofluorescence provide spatial information about KCNJ10 expression in tissue sections. For higher resolution subcellular localization, immunogold electron microscopy can be employed. Mass spectrometry-based proteomics offers an antibody-independent approach for identification and quantification. For detecting KCNJ10 at the cell surface specifically, the biotinylation method described previously is particularly valuable . The choice of method should be guided by the specific research question, sample type, and required sensitivity.

What is the optimal experimental design for evaluating KCNJ10 function in primary glial cultures?

The optimal experimental design for evaluating KCNJ10 function in primary glial cultures involves a multi-modal approach. Cultures should be established from cortical tissue of neonatal rodents, with astrocytes isolated through differential adhesion or immunopanning techniques. KCNJ10 expression should be confirmed using immunocytochemistry and western blotting. Functional assessment should primarily utilize whole-cell patch-clamp recordings, focusing on inwardly rectifying potassium currents with the solutions described in section 2.1. Barium (100-500 μM) can be applied as a selective blocker to isolate KCNJ10-mediated currents. Complementary techniques should include potassium-sensitive microelectrode recordings to measure extracellular potassium dynamics during stimulated neuronal activity in mixed neuron-glia cultures. RNA interference (siRNA or shRNA) targeting KCNJ10 should be employed as negative controls to confirm current identity. For investigating regulatory mechanisms, cultures can be exposed to different stimuli (inflammatory cytokines, hypoxia, or mechanical stretch) that model pathological conditions, with subsequent assessment of channel function and expression.

How can researchers distinguish between homomeric KCNJ10 channels and heteromeric channels formed with other Kir subunits?

Distinguishing between homomeric KCNJ10 channels and heteromeric channels formed with other Kir subunits requires a combination of electrophysiological, pharmacological, and molecular approaches. Electrophysiologically, each channel configuration produces distinctive current-voltage relationships and single-channel conductances that can be measured using patch-clamp techniques. Heteromeric channels often display intermediate properties between those of constituent homomeric channels. Pharmacologically, differential sensitivity to blockers like barium, cesium, and pH can help identify channel composition, as heteromeric channels may show unique pharmacological profiles. Molecularly, co-immunoprecipitation can identify physical interactions between KCNJ10 and other Kir subunits. For definitive characterization, researchers should employ concatemeric constructs where two different subunits are linked into a single protein, ensuring fixed stoichiometry and arrangement. Additionally, Förster resonance energy transfer (FRET) between fluorescently tagged subunits can provide evidence of close association and heteromerization in living cells. Combining these approaches allows reliable distinction between different channel configurations.

What are the most effective genotyping strategies for identifying KCNJ10 mutations in patients with suspected SeSAME/EAST syndrome?

For identifying KCNJ10 mutations in patients with suspected SeSAME/EAST syndrome, a tiered genotyping strategy is recommended. Initially, targeted sequencing of the KCNJ10 gene should be performed, focusing on all exons and exon-intron boundaries. For more comprehensive analysis, next-generation sequencing panels that include KCNJ10 and other genes associated with epilepsy, ataxia, and renal salt-wasting disorders should be employed. If these approaches are negative but clinical suspicion remains high, whole exome sequencing is warranted, as it can detect both mutations in KCNJ10 and potential modifier genes or digenic causes . For all identified variants, validation by Sanger sequencing is essential. Analysis should include bioinformatic prediction of mutation effects using tools like PolyPhen-2, PROVEAN, SIFT, and MutationTaster . Parental testing should be conducted to establish inheritance patterns and distinguish between compound heterozygosity and potential de novo mutations. This comprehensive approach ensures thorough genetic characterization and can reveal complex genetic interactions, such as the co-occurrence of KCNJ10 and KCNT1 mutations that has been associated with a more severe phenotype .

What therapeutic approaches are being investigated for KCNJ10-related disorders?

Current therapeutic approaches for KCNJ10-related disorders focus primarily on symptom management, but several promising targeted strategies are under investigation. For seizure management, anti-epileptic drugs that enhance inhibitory neurotransmission or modulate potassium channel function show potential. Renal manifestations are typically managed with electrolyte supplementation and diuretics tailored to the specific imbalances. Emerging approaches include pharmacological chaperones designed to rescue trafficking-defective mutant KCNJ10 channels to the cell surface, particularly relevant for mutations that affect protein folding or membrane targeting rather than channel function. Gene therapy approaches using viral vectors to deliver functional KCNJ10 to affected tissues represent another promising avenue. Additionally, CRISPR-Cas9 gene editing technologies offer potential for correction of pathogenic mutations in appropriate models. For cases with digenic pathology, such as combined KCNJ10 and KCNT1 mutations , therapeutic approaches may need to target multiple channels. Precision medicine strategies involving patient-derived cellular models (iPSCs differentiated into relevant cell types) allow for personalized drug screening to identify compounds that might ameliorate channel dysfunction for specific mutations.

What are the current gaps in our understanding of KCNJ10 function and pathology?

Despite significant advances, several critical gaps remain in our understanding of KCNJ10 function and pathology. The precise mechanisms by which KCNJ10 mutations lead to the diverse symptoms of SeSAME/EAST syndrome are not fully elucidated, particularly the developmental aspects of the disorder. The role of KCNJ10 in different cell types within the central nervous system beyond astrocytes remains underexplored. The potential contributions of heterozygous KCNJ10 mutations to more common neurological disorders like epilepsy, especially when combined with genetic variants in other channels, require further investigation following the discovery of lethal digenic mutations in KCNJ10 and KCNT1 . The regulatory mechanisms controlling KCNJ10 expression and function under physiological and pathological conditions are incompletely understood. Additionally, the molecular determinants of tissue-specific KCNJ10 function that explain why some mutations affect multiple systems while others primarily impact specific tissues need clarification. Addressing these knowledge gaps will require integrated approaches spanning from molecular studies to clinical investigations.

What technological advances are needed to better study KCNJ10 in its native environment?

Advancing our understanding of KCNJ10 function in its native environment requires several technological innovations. Development of more specific antibodies and fluorescent probes would enable better visualization of KCNJ10 localization and dynamics in live tissues. Improved methods for simultaneous electrophysiological recording and imaging would allow real-time correlation between channel function and cellular processes. Advanced gene editing techniques optimized for astrocytes, oligodendrocytes, and renal epithelial cells would facilitate more precise manipulation of KCNJ10 in relevant cell types. Development of tissue-specific inducible knockout models would help distinguish developmental versus acute effects of KCNJ10 dysfunction. Non-invasive imaging techniques with sufficient resolution to monitor potassium dynamics in vivo would provide unprecedented insights into channel function in intact organisms. For clinical translation, development of high-throughput screening platforms using patient-derived cells to identify compounds that rescue mutant channel function would accelerate therapeutic discovery. These technological advances would collectively transform our ability to study KCNJ10 under physiologically relevant conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.