Recombinant Human ATP-sensitive inward rectifier potassium channel 11 (KCNJ11)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human ATP-Sensitive Inward Rectifier Potassium Channel 11 (KCNJ11)

The Recombinant Human ATP-sensitive inward rectifier potassium channel 11, commonly referred to as KCNJ11, is a protein that in humans is encoded by the KCNJ11 gene . KCNJ11 gene mutations are the most common cause of permanent neonatal diabetes, which appears in the first six months of life .

Function and Significance

  • KCNJ11 is a member of the inward rectifying potassium channel family . These channels play a crucial role in various cell types, including excitable and non-excitable cells found in multiple organ systems. They are essential for maintaining cellular membrane potential and regulating electrical excitability.

  • Specifically, KCNJ11 encodes the pore-forming subunit of the ATP-sensitive potassium (KATP) channel . KATP channels are vital in coupling cellular metabolism to electrical activity. They are composed of two subunits: the sulfonylurea receptor (SUR) and a member of the Kir6.0 family of inward rectifier potassium channels. KCNJ11 encodes the Kir6.2 subunit, which forms the ion-conducting pore.

3.1. Diabetes Mellitus

Mutations in the KCNJ11 gene are notably associated with various forms of diabetes mellitus .

  • Permanent Neonatal Diabetes Mellitus (PNDM): KCNJ11 mutations are the most frequent cause of PNDM, which manifests within the first six months of life .

  • Type 2 Diabetes (T2D): Genetic variations in KCNJ11, such as the rs5219 polymorphism, have been linked to an increased risk of T2D, particularly in East Asian populations . A meta-analysis indicated that the KCNJ11 polymorphism (rs5219) is associated with T2D risk in both East Asian and global populations .

3.2. Neurological and Cognitive Function

Research indicates that KCNJ11 gene mutations can impact cognitive and neurological functions .

  • Individuals with KCNJ11 mutations may exhibit lower IQ scores and cognitive impairments .

  • Specific cognitive functions, such as attention, executive function, and visuospatial function, may be affected .

The study by Dunne, et al., 2019, provides detailed cognitive assessments of individuals with KCNJ11 mutations :

Cognitive DomainKCNJ11 Group (Median)INS Group (Median)P-value
IQ761110.02
ACE-R (Cognitive Impairment)Below clinical cut pointN/AN/A
CTT-1 (Attention)-1.70.40.03
WASI Matrix Reasoning-3.20.60.008
WAIS Digit Span-2.000.046
Cancellation Score-12.80.007

Note: Data from Dunne, et al., 2019, comparing cognitive function in individuals with KCNJ11 mutations versus INS mutations .

4.1. Antiseizure Drug Development

Modulation of potassium channels, including KCNJ11, has emerged as a potential therapeutic strategy for neurological disorders such as epilepsy .

  • KA-11 and its analogs, which combine structural fragments of existing antiseizure drugs, have demonstrated strong antiseizure and neuroprotective properties in preclinical studies .

  • These compounds have shown efficacy in acute mouse seizure models, including maximal electroshock seizures (MES) and subcutaneous pentylenetetrazole (scPTZ) seizures .

4.2. Cancer Therapy

Potassium channels, including Kv11.1, have been identified as potential targets in cancer therapy .

  • Activation of Kv11.1 channels has been shown to inhibit tumor growth in breast cancer models by inducing DNA damage and senescence .

  • Pharmacological stimulation of Kv11.1 activity may represent a novel approach for treating breast tumors .

5.1. Genetic Studies

  • Meta-Analyses: Meta-analyses have been conducted to assess the association between KCNJ11 polymorphisms and the risk of type 2 diabetes across different populations .

  • Population-Specific Impacts: Studies have explored the population-specific impacts of genetic variants in KCNJ11 on the risk of type 2 diabetes .

5.2. Functional Studies

  • In Vitro and In Vivo Characterization: Functional studies have characterized the effects of KCNJ11-related compounds using both in vitro and in vivo models . These studies help elucidate the mechanisms of action and therapeutic potential of targeting KCNJ11.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations are stable for 6 months at -20°C/-80°C, while lyophilized forms are stable for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
KCNJ11; ATP-sensitive inward rectifier potassium channel 11; IKATP; Inward rectifier K(+ channel Kir6.2; Potassium channel, inwardly rectifying subfamily J member 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-390
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
KCNJ11
Target Protein Sequence
MLSRKGIIPEEYVLTRLAEDPAEPRYRARQRRARFVSKKGNCNVAHKNIREQGRFLQDVF TTLVDLKWPHTLLIFTMSFLCSWLLFAMAWWLIAFAHGDLAPSEGTAEPCVTSIHSFSSA FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET LIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM ENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDHSLLEALT LASARGPLRKRSVPMAKAKPKFSISPDSLS
Uniprot No.

Target Background

Function

This G protein-regulated receptor belongs to the inward rectifier potassium channel family. These channels exhibit a higher permeability for potassium influx than efflux. Their voltage dependence is modulated by extracellular potassium concentration; increased extracellular potassium shifts the channel activation voltage to more positive potentials. Inward rectification primarily results from intracellular magnesium block of outward current. Extracellular barium can block the channel. KCNJ11 is a subunit of ATP-sensitive potassium (KATP) channels, capable of forming cardiac and smooth muscle-type KATP channels with ABCC9. KCNJ11 forms the channel pore, while ABCC9 is crucial for activation and regulation.

Gene References Into Functions
  1. A novel form of late-onset persistent hyperinsulinemic hypoglycemia of infancy (PHHI), caused by a dominant KCNJ11 mutation affecting Kir6.2 surface expression, is described. PMID: 29087246
  2. KCNJ11 genetic variation is associated with prediabetes. PMID: 28449408
  3. Structural analysis reveals a lasso extension mediating the interaction between SUR1 and Kir6.2 near the ATP binding site, influencing ADP's regulatory role in overriding ATP inhibition. PMID: 29286281
  4. Combined heterozygous mutations in ABCC8 and KCNJ11 genes can lead to beta-cell dysfunction manifesting as congenital hyperinsulinism. PMID: 29127764
  5. A KCNJ11 gene deletion did not affect key pluripotent factor expression levels, maintaining normal karyotype and differentiation potential. PMID: 29034901
  6. KCNJ11 genetic variants significantly reduced pancreas weight and insulin mass, mirroring type 1 diabetes. PMID: 28938416
  7. Studies confirm the association of KCNJ11 and ABCC8 mutations with neonatal diabetes mellitus, identifying novel mutations in both genes. PMID: 27681997
  8. Individuals with KCNJ11-related neonatal diabetes mellitus (NDM) exhibit a higher risk of developmental delays, sleep disturbances, and ADHD. PMID: 27555491
  9. The T allele of the Glu23Lys polymorphism in KCNJ11 is associated with increased risk of type 2 diabetes mellitus in the Kyrgyz population. PMID: 29171469
  10. Evaluation of Glutathione Peroxidase and KCNJ11 Gene Polymorphisms in Patients with New Onset Diabetes Mellitus After Renal Transplantation. PMID: 28073131
  11. Clinical features of two siblings with a heterozygous C679G>A mutation in KCNJ11 are reported. PMID: 28347637
  12. Upregulated KCNJ11 expression predicts poor prognosis in hepatocellular carcinoma (HCC), regulated by NF-κB signaling and partially mediated by LDHA. PMID: 29108994
  13. Neurodevelopmental issues, even without global developmental delays, are described in individuals with KCNJ11 mutations. PMID: 27223594
  14. Standardized questionnaires reveal significant psychiatric morbidity in children with KCNJ11-related neonatal diabetes, highlighting the need for integrated clinical care. PMID: 27086753
  15. Increased Kir6.2 expression is observed in reactive astrocytes in aged 3xTg-Alzheimer's disease mice and human AD tissue. PMID: 27586053
  16. Loss-of-function KCNJ11 mutations cause congenital hyperinsulinism, affecting various metabolic pathways including calcium handling, insulin secretion, and GABA levels. PMID: 28442472
  17. The Kir6.2-G324R mutation reduces channel ATP sensitivity, with a less pronounced difference between homozygous and heterozygous channels, yet resulting in neonatal diabetes in homozygous individuals only. PMID: 27118464
  18. Reduced KCNJ11 expression is observed in human ischemic cardiomyopathy. PMID: 28209764
  19. The Glu23Lys polymorphism in KCNJ11 is associated with hypertension in the Kyrgyz population. PMID: 28252621
  20. KATP channel inhibitors enhance interactions between Kir6.2 N-terminus and SUR1, suggesting that they improve channel biogenesis and trafficking. PMID: 27573238
  21. No significant differences in KCNJ11 Glu23Lys genotype frequencies were observed between control and type 1 or type 2 diabetes groups. PMID: 28387875
  22. KCNJ11 mutations are associated with permanent neonatal diabetes. PMID: 27428845
  23. Successful management of congenital hyperinsulinism (CHI) in an infant with a novel homozygous p.F315I KCNJ11 mutation using sirolimus is reported. PMID: 27181099
  24. The ABCC8 gene is most frequently mutated in Turkish patients with congenital hyperinsulinism (CHI), followed by HADH and KCNJ11. PMID: 27181376
  25. A patient presented with diffuse congenital hyperinsulinism and hemihypertrophy due to a mosaic, paternally inherited KCNJ11 mutation and chromosome 11 uniparental disomy (UPD). PMID: 27173951
  26. Coexistence of mosaic uniparental isodisomy and a KCNJ11 mutation is reported in a patient presenting with diffuse congenital hyperinsulinism and hemihypertrophy. PMID: 27174046
  27. Smoking status and KCNJ11 genotype may interact to influence the antihypertensive effects of irbesartan in the Chinese Han population. PMID: 26304961
  28. Combined genetic variants showed a borderline significant association with glibenclamide efficacy, with gene-gene interactions between KCNJ11 and CDKN2A/2B. PMID: 27008632
  29. Homozygous KCNJ11 mutations are associated with persistently elevated insulin concentrations. PMID: 26581065
  30. Common variants in KCNJ11 and BAD do not predict response to ketogenic dietary therapies. PMID: 26590798
  31. KCNJ11 genetic variants may contribute to the development of diabetes mellitus. PMID: 26448950
  32. Mitochondrial ATP-sensitive potassium (mtKATP) channels are overexpressed in glioma cells, correlating with malignancy grade and patient survival. PMID: 25249341
  33. KCNJ11 mutations are associated with neonatal diabetes mellitus. PMID: 25781672
  34. Epigenetic alterations at the 11p15 region play a key role in focal congenital hyperinsulinism (CHI) development, linked to paternally derived KATP channel mutations and maternal allelic loss. PMID: 25765446
  35. Human odorant receptors (hORs) were coupled to the Kir6.2 potassium channel for odorant detection. PMID: 25931017
  36. A retrospective cohort study analyzed data from 58 individuals with KCNJ11 mutation-related neonatal diabetes. PMID: 25877689
  37. The KCNJ11 rs5219 polymorphism is associated with type 2 diabetes. PMID: 26841550
  38. KCNJ11 SNP was associated with diabetic retinopathy in Chinese Han patients with type 2 diabetes mellitus (T2DM). PMID: 25573672
  39. Causal genetic variation within the ABCC8/KCNJ11 region for type 2 diabetes mellitus was identified. PMID: 25955821
  40. KCNJ11 A190A-TT or E23K-GG carriers exhibited higher systolic blood pressure (SBP) than CC or AA carriers in both non-diabetic and T2DM groups. PMID: 25725792
  41. KCNJ11 encodes the Kir6.2 subunit of the pancreatic beta-cell ATP-sensitive potassium channel; mutations impair insulin secretion. PMID: 25678012
  42. KCNJ11 polymorphisms might increase the risk of new-onset diabetes after transplantation (NODAT) in tacrolimus-treated patients after liver transplantation. PMID: 24996284
  43. Paternally inherited heterozygous ABCC8/KCNJ11 mutations can cause a wide spectrum of congenital hyperinsulinism. PMID: 25201519
  44. The KCNJ11 E23K variant is associated with a greater response to sulfonylurea treatment. PMID: 25115353
  45. Case-control and meta-analyses reveal a significant association between the KCNJ11 E23K variant and type 2 diabetes, influenced by ethnicity. PMID: 25247988
  46. Associations between T2DM and polymorphic markers of KCNJ11, SLC30A8, and CDKN2B genes were found in a Russian population; no such association was found for the FTO gene. PMID: 25916116
  47. Meta-analysis showed an association between IGF2BP2, KCNJ11, and CDKAL1 polymorphisms and type 2 diabetes mellitus in a Moroccan population. PMID: 24898818
  48. Case-control and meta-analyses indicate a significant association between the KCNJ11 E23K variant and type 2 diabetes in Tunisian and Arab populations. PMID: 25165692
  49. A novel missense heterozygous mutation in KCNJ11 at codon 167 is identified, located within a predicted intracellular gate of the ATP-sensitive potassium channel. PMID: 24468099
  50. Efficacy of glibenclamide and sitagliptin therapy in adult patients with KCNJ11-related permanent diabetes is studied. PMID: 24558086
Database Links

HGNC: 6257

OMIM: 600937

KEGG: hsa:3767

STRING: 9606.ENSP00000345708

UniGene: Hs.248141

Involvement In Disease
Familial hyperinsulinemic hypoglycemia 2 (HHF2); Diabetes mellitus, permanent neonatal (PNDM); Transient neonatal diabetes mellitus 3 (TNDM3); Maturity-onset diabetes of the young 13 (MODY13)
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ11 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the role of KCNJ11 in human physiology?

KCNJ11 encodes the Kir6.2 subunit of ATP-sensitive potassium (KATP) channels, which are critical for glucose sensing and insulin secretion in pancreatic β-cells. Additionally, these channels are expressed in various brain regions, particularly with high levels in the cerebellum . In the CNS, KATP channels play roles in glucose sensing, homeostasis, and seizure propagation, as evidenced by rodent studies . The channel's function in the cerebellum appears to extend beyond motor learning and coordination to include influences on language, executive function, mood regulation, and potentially autism-related processes .

How do KCNJ11 mutations specifically affect neurological development?

KCNJ11 mutations lead to characteristic developmental abnormalities that persist into adulthood. These include:

  • Delayed developmental milestones requiring learning support or special schooling

  • Subtle deficits in coordination and motor sequencing (observed in 7/8 individuals with KCNJ11 mutations in one study)

  • Impaired attention, working memory, and perceptual reasoning

  • Reduced IQ (median IQ of 76 in KCNJ11 mutation carriers compared to 111 in INS mutation carriers)

  • Features consistent with autism spectrum disorder in approximately 50% of affected individuals

These neurological features appear to be direct consequences of aberrant KATP channel function in the brain rather than secondary to diabetes, as they persist despite excellent glycemic control with sulfonylurea therapy .

What expression systems are most effective for recombinant KCNJ11 production?

For recombinant KCNJ11 expression, the T7 promoter system in E. coli, particularly using pET vectors in BL21(DE3) strains, offers significant advantages. This system can yield target protein constituting up to 50% of total cellular protein under optimal conditions . The expression system components include:

  • A plasmid containing the KCNJ11 gene under control of a T7 promoter

  • Host cells (typically BL21(DE3)) expressing T7 RNA polymerase

  • Induction system using IPTG or lactose

  • Optional T7 lysozyme co-expression (using pLysS or pLysE plasmids) to control basal expression

For membrane proteins like KCNJ11, specialized strains with modified membrane composition or eukaryotic expression systems may yield better results for obtaining properly folded, functional protein.

What tagging strategies optimize KCNJ11 purification and detection?

Several tagging approaches can be employed for KCNJ11 purification with different advantages:

Tag TypeSizeDetection MethodPurification MethodAdvantagesConsiderations
Poly-His6-10 aaWestern blot, ELISANi-NTA chromatographySmall size, inexpensive purificationMay affect protein folding
FLAG8 aaWestern blotAnti-FLAG affinityHigh specificityExpensive purification
Strep II8 aaWestern blotStreptavidin affinityGentle elutionModerate cost
MBP~40 kDaWestern blot, activityAmylose resinEnhances solubilityLarge size may affect function

For KCNJ11, a C-terminal His-tag is often preferred since the N-terminus contains functional domains crucial for channel assembly and trafficking . The tag position should be chosen carefully as it may interfere with protein folding or function - placing the tag at the solvent-accessible end of the protein is recommended if structural information is available .

How can I optimize solubility of recombinant KCNJ11?

Optimizing solubility of recombinant KCNJ11 requires addressing several factors:

  • Expression temperature: Lowering to 18-25°C often improves folding

  • Fusion partners: Consider using solubility-enhancing fusion partners such as:

    • MBP (Maltose Binding Protein)

    • TRX (Thioredoxin)

    • GST (Glutathione S-transferase)

  • Detergent selection: For membrane proteins like KCNJ11, appropriate detergents are critical:

    • DDM (n-Dodecyl β-D-maltoside)

    • LMNG (Lauryl maltose neopentyl glycol)

    • Digitonin for native-like conditions

  • Co-expression with partner proteins: KCNJ11 functions in complex with SUR1, so co-expression may improve folding and stability

Solubility can be assessed throughout purification by comparing total protein to soluble fraction using SDS-PAGE and Western blotting with anti-tag antibodies .

What are the most reliable methods to assess KCNJ11 channel function in vitro?

Functional characterization of recombinant KCNJ11 channels can be performed using several complementary approaches:

  • Electrophysiological recordings:

    • Patch-clamp analysis (whole-cell or single-channel configurations)

    • Two-electrode voltage clamp in Xenopus oocytes expressing recombinant KCNJ11

    • Automated planar patch systems for higher throughput

  • Flux assays:

    • 86Rb+ efflux measurements to assess channel activity

    • Membrane potential-sensitive dyes (e.g., FLIPR-based assays)

  • Binding assays:

    • [3H]-glibenclamide binding to assess drug interactions

    • ATP binding assays to evaluate nucleotide sensitivity

When designing these experiments, it's important to consider that functional KATP channels require co-expression of KCNJ11 with sulfonylurea receptor subunits (SUR1/SUR2), as these form heteroctameric complexes in vivo.

How can I differentiate between normal and mutant KCNJ11 function experimentally?

To differentiate between normal and mutant KCNJ11 function:

  • ATP sensitivity assays:

    • Wild-type channels typically show half-maximal inhibition at 10-50 μM ATP

    • Many PNDM-causing mutations significantly reduce ATP sensitivity

    • Construct concentration-response curves with ATP concentrations ranging from 0.1 μM to 10 mM

  • Sulfonylurea response:

    • Measure channel inhibition by sulfonylureas (e.g., glibenclamide)

    • PNDM mutations may alter sulfonylurea sensitivity

    • Compare EC50 values between wild-type and mutant channels

  • Single-channel kinetics:

    • Record open probability, mean open time, and conductance

    • Mutations often increase open probability and alter gating kinetics

  • PIP2 sensitivity:

    • Assess channel response to phosphatidylinositol 4,5-bisphosphate (PIP2)

    • Some mutations alter PIP2 interactions, affecting channel regulation

These functional differences correlate with clinical phenotypes, with more severe channel dysfunction typically associating with more pronounced neurological features .

How do KCNJ11 mutations differentially affect pancreatic versus neurological function?

Research comparing pancreatic and neurological phenotypes in KCNJ11 mutation carriers reveals several important distinctions:

  • Tissue-specific responses to therapy:

    • Pancreatic dysfunction typically responds well to sulfonylurea therapy

    • Neurological features show only partial improvement despite excellent metabolic control

  • Temporal differences:

    • Diabetes typically manifests in the first 6 months of life

    • Neurological features develop gradually and persist into adulthood

  • Mutation-specific effects:

    • Different mutations along the KCNJ11 gene affect pancreatic and neurological functions to varying degrees

    • This suggests region-specific channel functions in different tissues

  • Compensatory mechanisms:

    • The brain appears to have fewer compensatory pathways to overcome KATP channel dysfunction compared to pancreatic tissue

Studies comparing individuals with KCNJ11 mutations to those with INS mutations (who have diabetes without neurological features) have been particularly informative in distinguishing direct CNS effects from secondary complications of diabetes .

What is the relationship between KCNJ11 mutation position and phenotypic severity?

The position and nature of KCNJ11 mutations correlate with phenotypic severity in both metabolic and neurological domains:

  • Mutations affecting the ATP-binding site (e.g., R201H, R201C):

    • Moderate reduction in ATP sensitivity

    • Typically cause isolated PNDM without severe neurological features

  • Mutations in the helical slide (e.g., V59M, V59A):

    • More profound reduction in ATP sensitivity

    • Associated with DEND syndrome (Developmental delay, Epilepsy, and Neonatal Diabetes)

    • Significant neurological impairment including motor and cognitive deficits

  • Mutations at the protein-protein interface (e.g., I296L):

    • Alter subunit interactions

    • Intermediate phenotypes with variable neurological features

This structure-function relationship provides insights into channel regions critical for tissue-specific functions and may guide personalized therapeutic approaches.

How can multi-omics approaches enhance our understanding of KCNJ11 pathophysiology?

Multi-omics strategies offer comprehensive insights into KCNJ11 pathophysiology:

  • Transcriptomics:

    • RNA-seq of tissues from models with KCNJ11 mutations reveals downstream pathway dysregulation

    • Alternative splicing patterns may differ between tissues

  • Proteomics:

    • Interactome analysis identifies KCNJ11 binding partners beyond SUR1/SUR2

    • Post-translational modifications affecting channel function

  • Metabolomics:

    • Metabolic signatures in different tissues with KCNJ11 dysfunction

    • Secondary metabolic adaptations to altered glucose sensing

  • Single-cell analyses:

    • Cell-specific responses to KCNJ11 dysfunction in heterogeneous tissues

    • Developmental trajectory alterations in neuronal populations

Integration of these data sets can reveal novel therapeutic targets and biomarkers for monitoring disease progression and treatment response.

How do different sulfonylureas compare in treating KCNJ11-related disorders?

Sulfonylureas, which bind to the SUR1 regulatory subunit of the KATP channel complex, have transformed treatment of KCNJ11-related diabetes. Their comparative efficacy varies:

SulfonylureaBinding AffinityBlood-Brain Barrier PenetrationEfficacy for Glycemic ControlEfficacy for Neurological Symptoms
GlibenclamideHighLimitedExcellentPartial improvement
GliclazideModeratePoorGoodMinimal effect
TolbutamideLowPoorModerateMinimal effect

While sulfonylureas achieve outstanding metabolic control, their effects on neurological features are less pronounced . This limited neurological improvement may be due to:

  • Incomplete penetration of the blood-brain barrier

  • Different channel sensitivities in CNS versus pancreatic tissues

  • Irreversible developmental effects occurring before treatment initiation

  • Potential compensatory mechanisms in the pancreas not present in the CNS

What are potential approaches to improve CNS outcomes in KCNJ11 mutation carriers?

Research into improving CNS outcomes for individuals with KCNJ11 mutations focuses on several promising strategies:

  • Modified sulfonylureas:

    • Enhanced blood-brain barrier penetration

    • CNS-targeted delivery systems

    • Altered binding properties specific to mutant channels

  • Combinatorial approaches:

    • Sulfonylureas plus cognitive/behavioral interventions

    • Addition of medications targeting downstream pathways

  • Developmental timing:

    • Earlier intervention before critical developmental windows close

    • Prenatal diagnosis and treatment consideration

  • Gene therapy approaches:

    • RNA editing to correct point mutations

    • Allele-specific silencing of mutant KCNJ11

    • CRISPR-based approaches for precise gene correction

  • Alternative channel modulators:

    • Compounds targeting the KCNJ11 subunit directly rather than SUR1

    • Allosteric modulators with mutation-specific effects

Longitudinal studies tracking neurological outcomes in early-treated patients will be crucial for evaluating the efficacy of these approaches .

How might CRISPR/Cas9 technologies advance KCNJ11 research and therapeutics?

CRISPR/Cas9 technologies offer transformative opportunities for KCNJ11 research:

  • Disease modeling:

    • Generation of precise knock-in mutations in human stem cells

    • Development of isogenic cell lines differing only in KCNJ11 status

    • Creation of animal models with human-relevant mutations

  • Functional genomics:

    • High-throughput screening of KCNJ11 variants of unknown significance

    • Identification of genetic modifiers affecting phenotypic expression

    • Characterization of regulatory elements controlling KCNJ11 expression

  • Therapeutic applications:

    • Ex vivo gene correction in patient-derived cells

    • In vivo base editing to correct common point mutations

    • Prime editing for precise correction without double-strand breaks

  • Delivery challenges:

    • Tissue-specific targeting strategies for pancreatic versus neuronal cells

    • Timing considerations for developmental disorders

    • Safety and off-target effect minimization

These approaches may eventually enable personalized therapeutic strategies tailored to specific mutations and individual patient characteristics.

What insights might brain imaging studies provide about KCNJ11's role in neurodevelopment?

Advanced neuroimaging techniques offer unique windows into KCNJ11's role in neurodevelopment:

  • Structural MRI findings:

    • Despite significant neurological and cognitive impairments, conventional MRI scans of individuals with KCNJ11 mutations have not revealed obvious structural brain abnormalities

    • This suggests subtle alterations in neural circuits rather than gross morphological changes

  • Functional neuroimaging opportunities:

    • fMRI could identify altered activation patterns during cognitive tasks

    • Connectivity analyses may reveal network-level disruptions

    • Spectroscopy could detect metabolic signatures of altered neural function

  • Developmental trajectory mapping:

    • Longitudinal imaging from early childhood through adulthood

    • Correlation with clinical progression and response to therapy

    • Comparison with age-matched controls and other forms of diabetes

  • Cerebellum-focused studies:

    • High-resolution imaging of cerebellar structures given KCNJ11's high expression in this region

    • Assessment of cerebellar-cortical connectivity patterns

    • Correlation of cerebellar metrics with motor and cognitive functions

These neuroimaging approaches could identify biomarkers for early intervention and provide insights into mechanisms of neurodevelopmental disruption.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.