Recombinant Human ATP-sensitive inward rectifier potassium channel 12 (KCNJ12)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human ATP-Sensitive Inward Rectifier Potassium Channel 12 (KCNJ12)

Recombinant Human KCNJ12 is a bioengineered form of the inwardly rectifying potassium channel Kir2.2, encoded by the KCNJ12 gene. This channel plays a critical role in stabilizing resting membrane potentials and regulating action potential waveforms in excitable cells, including neurons, skeletal muscle, and cardiac tissue . Its recombinant production enables structural, functional, and therapeutic studies, particularly in cardiovascular and neurological disorders.

Expression Systems and Purification

While bacterial systems (e.g., E. coli) have been used for homologs like rat KCNJ12 , human KCNJ12 remains challenging to express in functional form. Key advancements include:

  • Yeast Expression: Recent studies employed budding yeast for human KCNJ12 production, though yields remain low .

  • Purification Methods: SDS-PAGE and chromatography are standard for isolating recombinant KCNJ12, with purity >90% reported .

SystemDetailsOutcome
E. coliN-terminal His-tagged rat KCNJ12 (1–427 aa)Functional protein for structural studies
YeastHuman KCNJ12 expression in Saccharomyces cerevisiaeLimited functional characterization

Mechanisms and Physiological Impact

KCNJ12 contributes to:

  1. Cardiac Inward Rectifier Current (IK₁): Stabilizes resting membrane potential and modulates action potential repolarization .

  2. Neuronal Excitability: Regulates action potential waveforms in neurons and skeletal muscle .

  3. Ischemic Arrhythmias: Reduced KCNJ12 expression in myocardial infarction (MI) correlates with ventricular tachycardia. Soluble epoxide hydrolase inhibitors (e.g., t-AUCB) upregulate KCNJ12, restoring IK₁ and reducing arrhythmias .

Pathological Links and Mutations

DiseaseMechanismReferences
Andersen-Tawil SyndromeMutations disrupt IK₁, causing periodic paralysis and cardiac dysrhythmias.
Smith-Magenis SyndromeDeletions in chromosome 17p11.1 (includes KCNJ12) cause neurodevelopmental defects.
Dilated Cardiomyopathy (DCM)KCNJ12 p.Glu334del mutation linked to familial DCM via impaired IK₁.
Port-Wine Stains (PWS)KCNJ12 mutations activate AKT pathway, promoting aberrant vascular growth.

The LOVD database lists 16 public KCNJ12 variants, including indels and missense mutations .

Current and Emerging Uses

ApplicationKey FindingsReferences
Cardiac Arrhythmia Modelst-AUCB (sEHi inhibitor) upregulates KCNJ12 in MI, reducing ventricular tachycardia.
Cancer BiomarkersKCNJ12 variants identified in esophageal squamous cell carcinoma via WES.
Structural StudiesChicken Kir2.2 (homolog) used for membrane protein crystallography.

Whole-exome sequencing (WES) has emerged as a critical tool for identifying KCNJ12 mutations in familial cardiomyopathies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
KCNJ12; IRK2; KCNJN1; ATP-sensitive inward rectifier potassium channel 12; Inward rectifier K(+ channel Kir2.2; IRK-2; Inward rectifier K(+ channel Kir2.2v; Potassium channel, inwardly rectifying subfamily J member 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-433
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
KCNJ12
Target Protein Sequence
MTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFANM DEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGIIFWVIAVAHGDLEPAEGRGR TPCVMQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAI MAKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEE GEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILE GMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPSTPRCSAK DLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGG VLEQRPYRRESEI
Uniprot No.

Target Background

Function

Kir2.2 (KCNJ12) is an inward-rectifying potassium channel activated by phosphatidylinositol 4,5-bisphosphate (PIP2). It plays a crucial role in regulating resting membrane potential in electrically excitable cells, contributing to action potential waveform and excitability in neuronal and muscle tissues. Inward rectifier potassium channels exhibit a preference for potassium influx. Their voltage dependence is modulated by extracellular potassium concentration; increasing external potassium shifts the channel opening voltage range to more positive values. Inward rectification primarily results from intracellular magnesium block of outward current.

Gene References Into Functions
  1. Studies using mouse Kir2.1 and human Kir2.2 demonstrated that a Leu residue enhances PIP2-mediated channel activation through increased binding affinity and faster kinetics, while deactivation kinetics decrease upon PIP2 inhibition. PMID: 26520451
  2. KCNJ12 gene mutations have been identified as a cause of familial dilated cardiomyopathy. PMID: 28816949
  3. Kir2.2 appears to play a physiological role in TLR4-stimulated monocytes by augmenting Ca2+ influx and cytokine release. PMID: 26324774
  4. Kir2.2 has been identified as a constitutive activator of RelA in cancer. PMID: 23269273
  5. Kir2.2 knockdown induces cancer cell senescence through reactive oxygen species accumulation. PMID: 20841375
  6. Kir2.2 heteromerization contributes to the Andersen syndrome phenotype. PMID: 12032359
  7. Functional KCNJ12 with an arginine residue at position 285 has been molecularly cloned. PMID: 12417321
  8. Kir2.2 channel transcripts are found in proliferative smooth muscle cells. PMID: 12598232
  9. Kir2.2 recovery from FCCP inhibition requires intracellular components, but ATP depletion alone does not replicate the differential inhibitory effect of FCCP. PMID: 19016473
Database Links

HGNC: 6258

OMIM: 602323

KEGG: hsa:3768

STRING: 9606.ENSP00000328150

UniGene: Hs.200629

Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ12 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is KCNJ12 and what is its physiological role?

KCNJ12 encodes an inwardly rectifying potassium (K+) channel that predominantly permits potassium flux into cells rather than out of them. The protein is activated by phosphatidylinositol 4,5-bisphosphate and contributes significantly to establishing action potential waveform and excitability in neuronal and muscle tissues . KCNJ12 is believed to be one of multiple inwardly rectifying channels that contribute to the cardiac inward rectifier current (IK1), which plays a crucial role in maintaining resting membrane potential in cardiomyocytes . The channel's voltage dependence is regulated by extracellular potassium concentration; as external potassium increases, the voltage range for channel opening shifts toward more positive voltages .

The inward rectification property is primarily attributed to blockage of outward current by internal magnesium ions. KCNJ12 belongs to the 2-TM channel family, which includes strong inward-rectifier channels (Kir2.x), G-protein-activated inward-rectifier channels (Kir3.x), and ATP-sensitive channels (Kir6.x) .

How does KCNJ12 differ from other potassium channel genes in the same family?

KCNJ12 shares structural similarities with other members of the inward rectifier potassium channel family but possesses distinct biophysical properties and tissue distribution patterns. While several potassium channels contribute to the cardiac IK1 current, KCNJ12 shows unique electrophysiological characteristics.

Unlike some related channels, KCNJ12 contains specific conserved domains including an inward rectifier potassium channel N-terminal domain (spanning amino acid residues 2-46) and a main inward rectifier potassium channel domain (spanning residues 47-383) . Computational analysis of the buffalo KCNJ12 reveals three transmembrane sequences (residues 84-106, 126-148, and 155-177) , which may differ slightly in human KCNJ12 but likely maintain similar topology.

The protein structure consists of approximately 34.43% alpha helices, 19.91% extended strands, 3.98% beta turns, and 41.69% random coils, contributing to its specific functional properties . Its closest paralog is KCNJ18 , which shares significant sequence homology but serves distinct physiological functions.

What are the optimal methods for cloning and expressing recombinant human KCNJ12?

Successful cloning and expression of recombinant human KCNJ12 require careful selection of methodologies tailored to research objectives. Based on established protocols, the following approach is recommended:

Cloning Procedure:

  • Design specific primers to amplify the complete coding sequence of KCNJ12 gene using tools such as Primer Premier 5.0 .

  • Perform RT-PCR using cDNA from relevant tissues, particularly cardiac samples which show high expression levels.

  • A typical PCR reaction system (25 μl) should contain:

    • 1 μl (25 ng/μl) cDNA template

    • 4 μl 2.5 mM mixed dNTPs

    • 12.5 μl 2×GC buffer

    • 0.5 μl 10 μM forward primer

    • 0.5 μl 10 μM reverse primer

    • 0.25 μl high-fidelity DNA polymerase

    • 6.25 μl sterile water

PCR Amplification Protocol:

  • Initial denaturation: 95°C for 5 min

  • 34 cycles of: 94°C for 30s, 58°C for 45s, 72°C for 2 min

  • Final extension: 72°C for 5 min

  • Termination: 4°C

Expression System:
The human KCNJ12 can be effectively expressed in mammalian cell lines such as COS-7 or CHO cells. For functional studies, the PCR products should be cloned into vectors like pMD18-T and subsequently subcloned into expression vectors like pcDNA3.1 using appropriate restriction enzymes (e.g., EcoRI) . Transfection can be performed using Lipofectamine 2000 following the manufacturer's recommendations .

It's essential to sequence multiple independent clones (minimum 10) bidirectionally to confirm the integrity of the cloned sequence before functional expression .

What heterologous expression systems are most suitable for studying KCNJ12 function?

The selection of an appropriate heterologous expression system is critical for accurate characterization of KCNJ12 function. Several systems have proven effective, each with distinct advantages:

Mammalian Cell Lines:
COS-7 and CHO cells are preferred for expression studies of human KCNJ12, particularly when these cell lines lack endogenous KATP channels . These systems allow for studying channel properties in a cellular environment relatively similar to human cells.

COSm6 cells have been successfully used for reconstitution studies of human KATP channels, demonstrating ATP- and glibenclamide-sensitive K+ channels when appropriate subunits are coexpressed . These cells provide a clean background for electrophysiological recordings with minimal interference from endogenous channels.

Human iPSC-derived Cardiomyocytes (hiPSC-CMs):
For more physiologically relevant studies, especially when investigating disease mechanisms, human-induced pluripotent stem cell-derived cardiomyocytes provide an excellent platform. This system accounts for the complex molecular environment in which ion channels function, including interactions with auxiliary subunits, cytoskeletal components, regulatory kinases, phosphatases, trafficking proteins, and extracellular matrix proteins .

When selecting an expression system, researchers should consider:

  • The specific research question (basic biophysical properties vs. disease mechanisms)

  • Required sensitivity for electrophysiological recordings

  • Need for post-translational modifications and protein-protein interactions

  • Compatibility with planned experimental techniques

How can the electrophysiological properties of recombinant KCNJ12 channels be accurately measured?

Electrophysiological characterization of KCNJ12 channels requires specialized techniques to capture their distinctive inward rectification properties and responses to modulators. The following approaches have proven effective:

Patch-Clamp Recordings:

  • Cell-attached configuration is useful for measuring channel activation by metabolic inhibition under physiological conditions .

  • Inside-out patch configuration with ATP-free internal solution allows direct assessment of ATP sensitivity and modulation by other cytoplasmic factors .

Recording Conditions:

  • Quasi-symmetrical K+ solutions (≈150 mmol/L) are recommended to accurately determine single-channel conductance.

  • Measurements should be performed at physiologically relevant membrane potentials (e.g., -40 mV for cardiac cells) .

  • For ATP sensitivity studies, maintain quasi-physiological free Mg2+ (≈0.7 mmol/L) or test in the absence of Mg2+ .

Key Parameters to Measure:

  • Single-channel conductance (≈80 pS at -40 mV in quasi-symmetrical ≈150 mmol/L K+ for cardiac channels)

  • Intraburst kinetics as a function of K+ driving force

  • Inward rectification properties

  • ATP sensitivity (typical IC50 ≈20 μmol/L with pseudo-Hill coefficient of ≈1)

  • Response to pharmacological modulators (e.g., glibenclamide, cromakalim, pinacidil)

  • Effects of ADP in the presence of Mg2+ when channels are inhibited by ATP

Data Analysis:
Analysis should quantify rectification properties, open probability, mean open and closed times, and response curves to various modulators. Statistical comparison with native channels from human cardiomyocytes can validate the recombinant system as an appropriate model.

What methods are recommended for studying KCNJ12 expression patterns across different tissues?

Understanding the tissue-specific expression patterns of KCNJ12 provides valuable insights into its physiological roles. The following methodological approach is recommended:

Quantitative Real-Time PCR (qRT-PCR):

  • Sample preparation: Extract RNA from multiple tissues of interest using standardized protocols to ensure RNA integrity.

  • cDNA synthesis: Perform reverse transcription using oligo(dT) primers or random hexamers.

  • Reference gene selection: Use established housekeeping genes (e.g., 18S rRNA) as endogenous controls .

  • Primer design for KCNJ12:

    • Forward primer: 5'-GGCAACCTACGCAAGAGC-3'

    • Reverse primer: 5'-CAGGATGGTGATGGGAGACA-3'

    • Expected amplicon size: 101 base pairs

  • qPCR reaction setup:

    • Use a high-quality qPCR master mix

    • Run reactions in technical triplicates

    • Include standard curves generated from serial dilutions of cDNA (preferably heart tissue for KCNJ12)

  • Data analysis: Calculate relative expression using the 2-ΔΔCT method with appropriate statistical analysis .

Western Blot Analysis:
Complement gene expression data with protein-level analysis using specific antibodies against KCNJ12.

Immunohistochemistry:
For spatial localization within tissues, immunohistochemical staining can reveal the cellular and subcellular distribution of KCNJ12 channels.

Single-Cell RNA Sequencing:
For highest resolution of expression patterns, particularly in heterogeneous tissues like the heart, single-cell RNA sequencing can identify cell-type specific expression profiles.

How are KCNJ12 mutations associated with cardiac arrhythmias?

KCNJ12 plays a significant role in cardiac electrophysiology, and its dysfunction has been implicated in several cardiac rhythm disorders. Though the search results don't provide extensive details on KCNJ12-specific mutations, we can infer from related channels and general principles:

The inward rectifier potassium current (IK1), to which KCNJ12 contributes, is crucial for maintaining the resting membrane potential and contributing to the terminal phase of repolarization in cardiomyocytes. Alterations in this current can lead to action potential abnormalities and arrhythmias .

Disease associations include Andersen Cardiodysrhythmic Periodic Paralysis, which is characterized by ventricular arrhythmias, periodic paralysis, and dysmorphic features . While many cases are associated with mutations in KCNJ2 (a related channel), the functional redundancy and similarity suggest KCNJ12 may be involved in similar pathophysiological mechanisms .

Mutations may affect:

  • Channel conductance or gating properties

  • Trafficking of the channel to the cell membrane

  • Interaction with regulatory proteins

  • Response to cellular metabolic changes

Research approaches to investigate disease-associated mutations should include:

  • Functional characterization using patch-clamp electrophysiology

  • Trafficking studies using fluorescently tagged constructs

  • In silico modeling to predict mutation effects on channel structure

  • Patient-derived hiPSC-CMs to study mutation effects in a relevant cellular context

What research approaches are most effective for studying the molecular mechanisms of KCNJ12-related disorders?

Investigating the molecular mechanisms of KCNJ12-related disorders requires a comprehensive approach that integrates multiple experimental systems and technologies:

Heterologous Expression Systems:
While traditional heterologous expression systems provide valuable insights into basic channel properties, they often fail to capture the complete disease mechanism . These systems assume a direct relationship between ion channel mutation and phenotype, but channels function as part of complex multi-protein assemblies in vivo .

Human iPSC-Derived Cardiomyocytes:
Patient-specific hiPSC-CMs offer a more physiologically relevant platform for studying disease mechanisms, as they preserve the patient's genetic background and provide a native-like cellular environment . This approach is particularly valuable for understanding how KCNJ12 dysfunction contributes to complex phenotypes such as those seen in Andersen-Tawil Syndrome.

Animal Models:
Species-specific differences in ion channel expression and function must be considered. For example, studies have characterized canine KCNJ12 to establish better translational models . When using animal models, it's essential to validate findings through comparative studies with human tissue or cells.

Multi-Omics Approaches:
Integration of genomics, transcriptomics, proteomics, and metabolomics data can provide a comprehensive view of how KCNJ12 dysfunction affects cellular and systemic physiology.

Clinical Correlation:
For translational relevance, research findings should be correlated with clinical phenotypes. The variability in disease presentation, even within families carrying the same mutation, highlights the importance of considering genetic modifiers and environmental factors .

A stratified approach that considers the heterogeneity of molecular mechanisms can lead to a deeper understanding of KCNJ12-related disorders and potentially identify novel therapeutic targets .

How do interactions with auxiliary proteins modulate KCNJ12 channel function?

KCNJ12 channels do not function in isolation but as part of multi-protein complexes that significantly influence their biophysical properties and cellular functions. Understanding these interactions is crucial for a complete characterization of channel behavior:

Ion channels, including KCNJ12, form complexes with:

  • Auxiliary subunits

  • Cytoskeletal components

  • Regulatory kinases and phosphatases

  • Trafficking proteins

  • Extracellular matrix proteins

  • Other ion channels

These interactions can modulate:

  • Channel conductance and gating kinetics

  • Voltage sensitivity and rectification properties

  • Response to cellular metabolites (e.g., ATP, ADP)

  • Pharmacological sensitivity

  • Membrane localization and stability

Research approaches to study protein-protein interactions include:

  • Co-immunoprecipitation followed by mass spectrometry

  • Proximity labeling techniques (BioID, APEX)

  • FRET/BRET analysis to detect interactions in living cells

  • Yeast two-hybrid screening

  • Protein complementation assays

When investigating these interactions, researchers should consider that:

  • The composition of channel complexes may vary between tissue types

  • Interactions may be dynamic and regulated by cellular signaling

  • Disease-associated mutations may disrupt normal protein-protein interactions

  • Heterologous expression systems may lack important interaction partners present in native tissues

What are the technical challenges in differentiating between KCNJ12 and other inward rectifier channel contributions to physiological currents?

Distinguishing the specific contribution of KCNJ12 from other inward rectifier channels presents significant experimental challenges due to overlapping properties and lack of highly selective pharmacological tools:

Challenges:

  • Functional redundancy: Multiple Kir channels contribute to similar currents, particularly in cardiac tissue where the IK1 current involves several channel types .

  • Pharmacological limitations: There is a scarcity of highly selective inhibitors or activators that can distinguish between closely related Kir channels.

  • Expression overlap: KCNJ12 is co-expressed with other Kir family members in many tissues, complicating the isolation of its specific contribution.

  • Biophysical similarities: The electrophysiological properties of different Kir channels often show substantial overlap, making it difficult to separate their individual contributions based on biophysical characteristics alone.

Methodological Approaches to Address These Challenges:

  • Genetic approaches:

    • RNA interference (siRNA, shRNA) targeted specifically against KCNJ12

    • CRISPR/Cas9-mediated knockout or knockin models

    • Dominant-negative constructs designed to selectively inhibit KCNJ12 function

  • Combined electrophysiology and molecular biology:

    • Correlation of current properties with quantitative expression data

    • Single-cell patch-clamp combined with single-cell RT-PCR

    • Heterologous expression of various Kir channel combinations to identify unique signatures

  • Mathematical modeling:

    • Computational approaches to deconvolute mixed currents based on subtle differences in kinetics or voltage dependence

    • Simulations to predict the relative contribution of different channels under various conditions

  • Channel-specific antibodies:

    • Use of highly specific antibodies for immunocytochemical localization

    • Antibody-based functional inhibition in intact cells or tissues

What emerging technologies show promise for advancing KCNJ12 research?

Several cutting-edge technologies are poised to transform our understanding of KCNJ12 biology and pathophysiology:

Cryo-Electron Microscopy (Cryo-EM):
High-resolution structural determination of KCNJ12 channels in different conformational states and in complex with regulatory proteins would provide unprecedented insights into channel function and modulation. Recent advances in Cryo-EM have made it possible to visualize membrane proteins at near-atomic resolution.

Optogenetic and Chemogenetic Tools:
Development of light-activated or drug-activated KCNJ12 variants would allow precise temporal control of channel activity in specific cell populations, enabling studies of the acute physiological consequences of channel activation or inhibition.

Organ-on-a-Chip Technology:
Integration of KCNJ12-expressing cells in microfluidic organ-on-a-chip platforms could recreate more physiologically relevant environments for studying channel function in the context of tissue-level physiology and drug responses.

CRISPR-Based Screening:
Genome-wide CRISPR screens could identify novel regulators and interacting partners of KCNJ12, potentially uncovering new therapeutic targets for KCNJ12-related disorders.

Single-Molecule Imaging:
Techniques such as single-molecule FRET could provide insights into the conformational dynamics of KCNJ12 channels in real-time, revealing transient states that are difficult to capture with traditional methods.

Artificial Intelligence and Machine Learning:
Application of AI approaches to analyze large datasets of channel properties, genetic variations, and clinical phenotypes could identify patterns and relationships that are not apparent through conventional analysis methods.

In Silico Drug Discovery:
Structure-based virtual screening and molecular dynamics simulations could accelerate the development of selective KCNJ12 modulators for both research and therapeutic applications.

How might comparative studies across species advance our understanding of KCNJ12 function?

Comparative studies of KCNJ12 across different species provide valuable insights into conserved functional elements and species-specific adaptations, informing both basic biology and translational research:

Evolutionary Conservation Analysis:
Sequence comparison of KCNJ12 across species reveals highly conserved domains that likely serve critical functions. For example, studies have identified conserved domains in buffalo KCNJ12, including the inward rectifier potassium channel N-terminal domain (amino acids 2-46) and a main channel domain (amino acids 47-383) . Phylogenetic analysis can reveal how channel properties have evolved to meet species-specific physiological demands.

Functional Comparison Studies:
Experiments comparing the electrophysiological properties of KCNJ12 from different species can reveal how structural differences translate to functional variations. For instance, researchers have characterized both human and canine KCNJ12 , providing valuable comparative data that helps determine which animal models best recapitulate human channel properties.

Translational Model Development:
Understanding species differences is crucial for developing relevant disease models. The canine KCNJ12 has been mapped to advance its use as a model for human cardiac electrophysiology studies . Similar comparative work with other species can identify the most appropriate models for specific research questions.

Benefits and Approaches:

  • Identify conserved regulatory mechanisms across species

  • Reveal species-specific adaptations that might inform human disease variability

  • Develop more predictive animal models for preclinical studies

  • Uncover natural variations that confer resistance to disease in certain species

Methodological Approaches:

  • Molecular cloning and expression of KCNJ12 from multiple species

  • Comparative electrophysiology using consistent recording conditions

  • Computational analysis of sequence conservation and predicted structural features

  • Cross-species tissue expression profiling using qRT-PCR or RNA-seq

  • Development of chimeric channels to identify functionally important domains

By integrating findings from multiple species, researchers can build a more comprehensive understanding of KCNJ12 biology that extends beyond what can be learned from studying human channels alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.