Recombinant Human ATP-sensitive inward rectifier potassium channel 14 (KCNJ14)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Human ATP-Sensitive Inward Rectifier Potassium Channel 14 (KCNJ14)

The Recombinant Human ATP-Sensitive Inward Rectifier Potassium Channel 14, encoded by the KCNJ14 gene, is an integral membrane protein and an inward-rectifier type potassium channel . KCNJ14 likely plays a role in controlling the excitability of cells and maintaining the resting membrane potential .

Gene and Protein Characteristics

CharacteristicDescription
Gene NameKCNJ14 (potassium inwardly rectifying channel subfamily J member 14)
FunctionInward-rectifier potassium channel, influences cell excitability and resting membrane potential
ExpressionExpressed in various tissues; altered expression levels are associated with different cancers
LocalizationIntegral membrane protein
InteractionsInteracts with various immune components, chemokines, and receptors, influencing immune responses

Role in Cancer

KCNJ14's role in cancer is complex, with studies indicating it can act as both an oncogene and a tumor suppressor depending on the cancer type .

Correlation with Immune Infiltration Cells

Immune Cell TypeCorrelation with KCNJ14 Expression
B cellsPositively correlated with LGG and GMBLGG tissues
T-cell CD4Positively correlated with LGG and GMBLGG tissues, COAD, COADREAD, LUAD, LUSC, BRCA, LIHC, etc.
T-cell CD8Negatively correlated with COAD, COADREAD, LUSC, STES, and STAD
Natural killer cellsPositive correlation observed in 26 types of tumors

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
KCNJ14; IRK4; ATP-sensitive inward rectifier potassium channel 14; Inward rectifier K(+ channel Kir2.4; IRK-4; Potassium channel, inwardly rectifying subfamily J member 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-436
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
KCNJ14
Target Protein Sequence
MGLARALRRLSGALDSGDSRAGDEEEAGPGLCRNGWAPAPVQSPVGRRRGRFVKKDGHCN VRFVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLAFWLIASLHGDLAA PPPPAPCFSHVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFV VGAVMAKMAKPKKRNETLVFSENAVVALRDHRLCLMWRVGNLRRSHLVEAHVRAQLLQPR VTPEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADFELV VILEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPGTPV CSAKELDERAEQASHSLKSSFPGSLTAFCYENELALSCCQEEDEDDETEEGNGVETEDGA ASPRVLTPTLALTLPP
Uniprot No.

Target Background

Function

Inward rectifier potassium channels are characterized by a preferential influx of potassium ions. Their voltage dependence is modulated by extracellular potassium concentration; increasing external potassium shifts the channel activation voltage to more positive potentials. Inward rectification primarily results from intracellular magnesium ion block of outward current. KCNJ14 encodes low-conductance channels with low affinity for the channel blockers barium and cesium.

Gene References Into Functions
  1. Using patch-clamp techniques, we characterized K(IR) channels in cultured pulmonary artery smooth muscle cells and compared them to cloned Kir2.1 and Kir2.4 channels. PMID: 17347781
Database Links

HGNC: 6260

OMIM: 603953

KEGG: hsa:3770

STRING: 9606.ENSP00000341479

UniGene: Hs.144011

Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ14 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed preferentially in retina.

Q&A

Basic Research Questions

  • What is the basic structure and function of KCNJ14?

    KCNJ14 (also known as Kir2.4) is a member of the inwardly rectifying potassium channel family characterized by a greater tendency to allow potassium to flow into the cell rather than out. The protein contains two transmembrane domains with cytoplasmic N and C termini, forming a tetrameric channel structure.

    Functionally, KCNJ14 displays voltage-dependent properties regulated by extracellular potassium concentration - as external potassium levels rise, the voltage range for channel opening shifts to more positive voltages. The inward rectification is primarily due to internal magnesium blockage of outward current. KCNJ14 generates low-conductance channels with relatively low affinity for channel blockers such as barium and cesium .

    Methodologically, structural studies typically employ X-ray crystallography or cryo-electron microscopy, while functional characterization relies on patch-clamp electrophysiology in expression systems like Xenopus oocytes or mammalian cell lines.

  • Where is KCNJ14 predominantly expressed in human tissues?

    KCNJ14 shows a tissue-specific expression pattern with predominant expression in:

    • Nervous system (particularly motor neurons)

    • Brain

    • Heart

    In zebrafish models, expression has been documented in:

    • Brain

    • Head

    • Heart

    • Neural tube

    For expression analysis, researchers should employ a combination of:

    • qRT-PCR for mRNA quantification

    • Western blotting for protein detection

    • Immunohistochemistry for tissue localization

    • RNA-seq for transcriptome-wide analysis

    • Single-cell sequencing for cell-type specific expression

  • What are the essential experimental tools for studying recombinant KCNJ14?

    Key experimental approaches include:

    • Expression systems: HEK293, CHO cells, or Xenopus oocytes for heterologous expression

    • Vector systems: pcDNA3.1 and similar mammalian expression vectors

    • Protein detection: Anti-KCNJ14 antibodies (validation critical due to variable specificity)

    • Functional analysis: Whole-cell patch-clamp recording with specific voltage protocols

    • Knockout/knockdown approaches: CRISPR-Cas9 genome editing, siRNA, or shRNA

    • Channel modulators: Barium chloride (blocker), cesium (blocker)

    When designing experiments, consider the low conductance properties of KCNJ14 channels, which may require sensitive electrophysiological equipment and optimized recording conditions .

  • How does KCNJ14 differ from other inward rectifier potassium channels?

    KCNJ14 (Kir2.4) belongs to the Kir2.x subfamily but exhibits distinct characteristics:

    FeatureKCNJ14 (Kir2.4)Other Kir2.x ChannelsKir3.x (G-protein activated)Kir6.x (ATP-sensitive)
    ConductanceLowVariable (Kir2.1: high)IntermediateLow
    Blocker affinityLow affinity to Ba²⁺ and Cs⁺Higher affinityVariableVariable
    ActivationConstitutively activeConstitutively activeRequires G-protein activationInhibited by ATP
    Key paralogKCNJ2 (Kir2.1)---
    ExpressionBrain, motor neuronsWidespreadCardiac, neuronsPancreas, heart, brain

    When comparing channel properties experimentally, standardized recording conditions are essential, including controlled temperature, identical ionic compositions, and matched expression levels .

Advanced Research Questions

Human KCNJ14: Comprehensive Research Atlas

Biochemical Properties and Functional Characteristics

PropertyKCNJ14 (Kir2.4) Characteristics
Protein Size542 amino acids (zebrafish F1R7M8)
Chromosome Location19q13.33 (human)
Exon Count3
Channel TypeInward rectifier potassium channel
ConductanceLow-conductance
RectificationStrong inward rectification
BlockersBarium and Cesium (low affinity)
DomainsPotassium channel inwardly rectifying transmembrane domain (IPR040445)
Inward rectifier potassium channel C-terminal (IPR041647)
Potassium channel inwardly rectifying Kir (IPR016449)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.