Recombinant Human ATP synthase protein 8 (MT-ATP8)

Shipped with Ice Packs
In Stock

Description

Introduction to MT-ATP8

MT-ATP8, officially known as mitochondrially encoded ATP synthase membrane subunit 8, constitutes one of the 13 protein-encoding genes in the human mitochondrial genome. This small but critical protein forms an integral component of mitochondrial ATP synthase (Complex V), the inner mitochondrial enzyme responsible for the final step of oxidative phosphorylation in the electron transport chain . As a subunit of the ATP synthase complex, MT-ATP8 contributes to the cellular mechanisms that generate ATP, the primary energy currency of cells.

The human MT-ATP8 gene exhibits several unique characteristics, including a 46-nucleotide overlap with the MT-ATP6 gene, highlighting the compact and efficient organization of the mitochondrial genome . When the complete human mitochondrial genome was first published, the MT-ATP8 gene was initially described as an unidentified reading frame called URF A6L, before its function was fully understood . This gene encodes a protein that plays a crucial role in maintaining the structural integrity and functional efficiency of the ATP synthase complex.

Function of MT-ATP8 in ATP Synthase

MT-ATP8 serves as an essential component of the ATP synthase complex (Complex V), which catalyzes ATP synthesis by utilizing an electrochemical gradient of protons across the inner mitochondrial membrane during oxidative phosphorylation . Although MT-ATP8 does not directly participate in proton transport, it provides crucial structural support that enables the proper functioning of the entire complex.

The F₀ region of ATP synthase, where MT-ATP8 is located, induces rotation of the F₁ region, which contains the catalytic sites for ATP synthesis. Together, these components create a pathway for proton movement across the membrane, coupling proton flow to ATP production . The presence of MT-ATP8 contributes to the stability of this rotary machinery, ensuring efficient energy conversion within the mitochondria.

Functionally, MT-ATP8 appears to have an analogous role to its yeast counterpart, where it serves as an integral component of the stator stalk . By anchoring firmly in the membrane, it prevents futile rotation, thus improving the efficiency of energy conversion during oxidative phosphorylation. This function is critical for maintaining optimal ATP production in human cells, particularly in tissues with high energy demands such as the brain, heart, and skeletal muscles.

Recombinant Production of Human MT-ATP8

The production of recombinant human MT-ATP8 presents several technical challenges due to its hydrophobic nature and mitochondrial origin. Various expression systems have been developed to overcome these obstacles and produce functional protein for research applications.

Expression systems for recombinant MT-ATP8 include yeast, mammalian cell cultures (such as HEK-293 cells), and bacterial systems . Each system offers distinct advantages depending on the intended application. Yeast expression systems can provide high yields and are suitable for structural studies, while mammalian expression systems may better preserve post-translational modifications relevant to human protein function.

Recombinant MT-ATP8, like other recombinant proteins, is typically produced with purification tags such as His-tag or Fc-tag to facilitate isolation and purification . These tags can be attached to either the N-terminus or C-terminus of the protein, depending on structural considerations and the intended application. Purification protocols generally involve affinity chromatography followed by additional steps to achieve high purity (>90%) required for functional and structural studies .

Table 1: Characteristics of Expression Systems for Recombinant MT-ATP8 Production

Expression SystemAdvantagesDisadvantagesTypical TagsPurity LevelApplications
YeastCost-effective, high yieldDifferent post-translational modificationsHis-tag>90%ELISA, structural studies
Mammalian (HEK-293)Native-like modificationsHigher cost, lower yieldFc-tag, His-tag>90%Functional assays, interaction studies
Bacterial (E. coli)Very high yield, economicalRefolding often required, inclusion bodiesHis-tagVariableAntibody generation, mass production

Research Applications of Recombinant MT-ATP8

Recombinant human MT-ATP8 has proven invaluable for various research applications, from fundamental investigations to disease-focused studies. Its availability has accelerated our understanding of mitochondrial function and dysfunction in both normal physiology and pathological conditions.

Structural studies utilizing recombinant MT-ATP8 have contributed significantly to our understanding of ATP synthase architecture. Three-dimensional structures of prokaryotic homologues of this subunit have been modeled based on electron microscopy data, revealing that it forms a transmembrane 4-α-bundle . These structural insights help explain how mutations in MT-ATP8 might disrupt ATP synthase function at the molecular level.

Functional analyses frequently employ recombinant MT-ATP8 to investigate its interactions with other subunits of the ATP synthase complex. Research has demonstrated that MT-ATP8 interacts closely with subunit a (ATP6), with certain conserved amino acids playing crucial roles in these interactions . The conserved threonine in position 6 causes the MT-ATP8 helix to fold toward the subunit a, and this internal hydrogen bond between its side-chain oxygen and the backbone carbonyl group of leucine in position 4 stabilizes the backbone bending of MT-ATP8 .

Disease modeling represents another significant application of recombinant MT-ATP8. By introducing disease-associated mutations into recombinant proteins, researchers can study the biochemical and structural changes that lead to pathology. This approach has been particularly valuable for understanding how MT-ATP8 mutations contribute to various mitochondrial disorders .

Clinical Significance of MT-ATP8

Mutations in the MT-ATP8 gene have been associated with a variety of neurodegenerative and cardiovascular disorders, underscoring the protein's clinical significance. These conditions include mitochondrial complex V deficiency, epilepsy, schizophrenia, autism, ataxia, and various cardiomyopathies .

The severity of these mitochondrial disorders can vary widely depending on the specific mutation and the percentage of mitochondria in each cell that carries the genetic change (heteroplasmy) . This variable presentation complicates diagnosis and treatment but highlights the importance of understanding MT-ATP8 function at the molecular level.

Several specific mutations in MT-ATP8 have been identified in patients with mitochondrial disorders. For example, the m.8403T>C variant, which results in an I13T substitution in the protein, has been associated with episodic weakness and progressive neuropathy . Other variants like m.8381A>G (T6A) have been linked to maternally inherited diabetes and deafness (MIDD) and left ventricular non-compaction cardiomyopathy .

Table 2: MT-ATP8 Mutations and Associated Clinical Manifestations

mtDNA VariantAmino Acid ChangeAssociated Disease/SyndromePathogenic ScoreClinical References
m.8381A>GT6AMIDD/LVNC cardiomyopathy0.47
m.8382C>TT6IEpisodic paralysis0.58
m.8403T>CI13TEpisodic weakness and progressive neuropathy0.77
m.8411A>GM16VSevere mitochondrial disorder0.63

Studies using recombinant MT-ATP8 proteins with these mutations have helped elucidate their effects on protein structure and function. Research suggests that the T6A/I substitutions might disrupt the characteristic bend in the MT-ATP8 helix, potentially destabilizing its interaction with subunit a and compromising ATP synthase function . This molecular understanding offers insights into disease mechanisms and potential therapeutic approaches.

Future Directions in MT-ATP8 Research

Research on recombinant human MT-ATP8 continues to evolve, with several promising directions for future investigation. Advances in structural biology techniques, including cryo-electron microscopy, are expected to provide more detailed insights into the protein's structure and interactions within the ATP synthase complex.

Therapeutic applications represent an exciting frontier in MT-ATP8 research. As our understanding of how MT-ATP8 mutations lead to disease improves, targeted interventions may become possible. For example, researchers are exploring the use of yeast models to study the effects of MT-ATP8 variants and understand their mechanisms of pathogenesis at the molecular level . These studies could potentially lead to the development of compounds that stabilize mutant proteins or enhance ATP synthase function in affected individuals.

The development of improved expression systems for recombinant MT-ATP8 will likely enhance protein yield and purity, facilitating more advanced structural and functional studies. Innovations in membrane protein expression and purification technologies are particularly relevant for hydrophobic proteins like MT-ATP8.

Personalized medicine approaches may also benefit from recombinant MT-ATP8 research. By characterizing the functional consequences of patient-specific mutations using recombinant proteins, clinicians could potentially develop tailored treatment strategies based on the specific molecular defects present in each case, moving beyond the current limitations in treating mitochondrial diseases.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MT-ATP8; ATP8; ATPASE8; MTATP8; ATP synthase protein 8; A6L; F-ATPase subunit 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-68
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNKPWEPKWTKICSLHSLPPQS
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) synthesizes ATP from ADP using the proton gradient across the mitochondrial membrane, generated by the respiratory chain's electron transport complexes. F-type ATPases comprise two domains: F1 (the extramembraneous catalytic core) and F0 (the membrane proton channel), linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a minor subunit of the F0 domain, located within the membrane alongside subunit a.
Gene References Into Functions
  1. ATP8 genetic polymorphisms and their association with breast cancer in the Mizoram Mongoloid population. PMID: 25896597
  2. The potential impact of MT-ATP8 polymorphisms on the pathogenesis of benign prostatic hyperplasia (BPH) in the German population. PMID: 25941154
  3. The importance of the mitochondrially encoded ATP synthase, complex V, in cellular energy production through ATP synthesis. PMID: 25756807
  4. The association of mutations in the ATP synthase F0 subunit 8 with diabetic peripheral neuropathy. PMID: 24456990
  5. Three mutations (at mtDNA positions 8502, 11994, and 13231) significantly associated with epilepsy, resulting in amino acid changes in MT-ATP8, MT-ND4, and MT-ND5 genes. PMID: 24440288
Database Links

HGNC: 7415

OMIM: 500006

KEGG: hsa:4509

STRING: 9606.ENSP00000355265

Involvement In Disease
Mitochondrial complex V deficiency, mitochondrial 2 (MC5DM2); Cardiomyopathy, infantile hypertrophic (CMHI)
Protein Families
ATPase protein 8 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is the structural role of MT-ATP8 in the ATP synthase complex?

MT-ATP8 (subunit 8) is located in the membrane part of the ATP synthase stator and forms a tight association with subunit a and subunits i/j. It forms an α-helix that spans the membrane and protrudes into the mitochondrial matrix. Unlike subunit a (ATP6), subunit 8 is not directly involved in the catalytic proton transfer process as it is positioned remote from the c-ring . Recent structural analyses of mammalian ATP synthases reveal that the first 29 amino acid residues of subunit 8 form a helix that bends ninety degrees toward subunit a helix 4 (aH4). This bending is facilitated by a conserved threonine at position 6, which forms internal hydrogen bonds with the backbone carbonyl group of leucine at position 4 . This structural arrangement appears critical for stabilizing the positioning of subunit a within the ATP synthase complex.

How conserved is the MT-ATP8 sequence across species and what does this indicate about its function?

The primary sequence of subunit 8 is not highly conserved across species, even among higher organisms. Interestingly, only the N-terminal region of yeast subunit 8 shows significant similarity to its human homologue . Despite this sequence divergence, the structural elements of the membrane portion of subunit 8 are preserved across species, suggesting functional conservation despite sequence variation. This pattern indicates that the three-dimensional structure and positioning of the protein, rather than specific amino acid sequences, may be the critical determinants of MT-ATP8 function. The preserved structural elements allow for modeling of human substitutions in yeast models, despite primary sequence differences . The conservation pattern suggests MT-ATP8 likely serves primarily as a structural stabilizing element rather than having direct catalytic activity.

What is the genomic relationship between MT-ATP8 and MT-ATP6?

MT-ATP8 and MT-ATP6 have a unique genomic arrangement in the mitochondrial DNA, with a 46 nucleotide overlap between the two genes . This overlapping genetic structure creates special considerations for researchers, as variants in the overlapping region can potentially affect both proteins simultaneously. When studying MT-ATP8 variants, researchers must carefully select variants in the gene fragment specific to subunit 8 only, excluding the overlapping region when attempting to isolate ATP8-specific effects . This genomic arrangement is an important consideration in the design and interpretation of genetic studies focused on MT-ATP8, as it creates challenges in attributing phenotypic effects to specific gene products.

Pathogenic Variants and Disease Associations

What methodologies are used to validate the pathogenicity of novel MT-ATP8 variants?

Validating the pathogenicity of novel MT-ATP8 variants requires a multi-faceted approach combining:

  • Genetic analysis: Determining if the variant segregates with disease in families and assessing its frequency in population databases.

  • Conservation analysis: Evaluating if the affected amino acid is conserved across species, particularly focusing on the structural conservation rather than sequence identity .

  • Structural modeling: Using available ATP synthase structures to model the effects of amino acid substitutions on protein folding, stability, and interactions with neighboring subunits .

  • Yeast modeling: Introducing equivalent mutations into yeast ATP8 genes to study effects in vivo and in vitro, which has proven successful for studying human MT-ATP8 variants despite sequence differences .

  • Biochemical analysis: Assessing the impact on ATP synthase activity, assembly, and stability in patient samples or model systems .

  • Clinical correlation: Comparing the phenotype with previously reported cases of confirmed pathogenic MT-ATP8 variants .

These combined approaches provide more robust evidence for pathogenicity than any single method alone.

How effective is Saccharomyces cerevisiae as a model system for studying human MT-ATP8 variants?

Saccharomyces cerevisiae (baker's yeast) has proven to be a valuable model organism for studying human MT-ATP8 variants despite differences in primary sequence. Researchers have successfully used yeast to study effects of variants in the MT-ATP6 gene, and have applied similar approaches to MT-ATP8 . The effectiveness of this model system is supported by several factors:

  • Structural conservation: Despite sequence differences, the structure of the membrane part of subunit 8 is preserved between yeast and humans, allowing for meaningful modeling of substitutions .

  • Ease of genetic manipulation: Researchers can create specific strains with mutations equivalent to human variants, as demonstrated with the m.8403T>C variant (equivalent to L13T in yeast) .

  • In vivo and in vitro assessment: Yeast models enable both cellular (in vivo) and isolated mitochondrial (in vitro) studies of ATP synthase function .

  • Available tools: Researchers have developed specialized yeast strains for these studies, including those with histidine-hemagglutinin tagged ATP6 to facilitate isolation and analysis .

The table below shows examples of yeast strains used for MT-ATP8 research:

Strain designationNuclear genotypeMitochondrial genotypeReference
KNY120MAT a ade2-1 his3-11,15 trp1-1 leu2-3,112 ura3-1 CAN1 arg8::hisGρ+ ATP6-WT ATP8
RKY194MAT a ade2-1 his3-11,15 trp1-1 leu2-3,112 ura3-1 CAN1 arg8::hisGρ+ ATP6-WT atp8::ARG8m
CPY1MAT a ade2-1 his3-11,15 trp1-1 leu2-3,112 ura3-1 CAN1 arg8::hisGρ+ ATP6-HisHA atp8-L13T

What biochemical assays are most informative for characterizing MT-ATP8 variant effects on ATP synthase function?

Several biochemical approaches provide valuable insights into how MT-ATP8 variants affect ATP synthase function:

  • ATP synthesis rate measurements: Direct assessment of ATP production capacity in isolated mitochondria provides quantitative data on functional impairment .

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE): This technique allows visualization of intact ATP synthase complexes and can reveal assembly defects or stability issues caused by MT-ATP8 variants .

  • Oxygen consumption measurements: Respirometry assays can detect changes in mitochondrial respiration linked to ATP synthase dysfunction .

  • Membrane potential assessments: Since ATP synthase function is linked to the mitochondrial membrane potential, measuring changes in this parameter can indicate functional impacts of variants .

  • Protein-protein interaction studies: Techniques such as co-immunoprecipitation can detect alterations in the interactions between subunit 8 and other components of the ATP synthase complex, particularly subunit a .

  • Hydrogen/deuterium exchange mass spectrometry: This technique can provide information about changes in protein dynamics and stability introduced by specific variants .

For yeast models, researchers have successfully employed mitochondrial isolation followed by functional assays to characterize the effects of variants equivalent to human MT-ATP8 mutations .

How do specific amino acid substitutions in MT-ATP8 affect protein structure and stability?

The effects of amino acid substitutions in MT-ATP8 vary depending on their position and the physicochemical properties of the substituted residue. Structural analysis of known variants provides insights into their molecular consequences:

Structural modeling approaches using recently available ATP synthase structures have significantly enhanced our ability to predict the consequences of these substitutions .

How does MT-ATP8 contribute to the assembly and stability of the ATP synthase complex?

MT-ATP8 plays a crucial structural role in the assembly and stability of the ATP synthase complex through several mechanisms:

What are the key challenges in developing therapeutic approaches for MT-ATP8-related disorders?

Developing therapeutics for MT-ATP8-related disorders faces several significant challenges:

  • Clinical heterogeneity: The wide spectrum of clinical features associated with MT-ATP8 variants, ranging from cardiomyopathy to neurological symptoms, complicates the design of clinical trials and targeted therapeutic approaches .

  • Heteroplasmy variability: Even individuals with similar mtDNA mutational loads exhibit high clinical variability, making it difficult to predict treatment responses and establish appropriate dosing regimens .

  • Tissue specificity: MT-ATP8 variants may affect different tissues with varying severity, requiring therapeutic approaches that can target the most affected tissues .

  • Limited natural history data: Until recently, comprehensive natural history studies of MT-ATP6/8 deficiency were lacking, creating challenges in designing trials with appropriate endpoints and outcome measures .

  • Accessibility to mitochondria: Any potential therapeutic agent must cross both the cell membrane and the mitochondrial membranes to reach its target, presenting pharmacokinetic challenges.

  • Genetic complexity: The overlap between MT-ATP8 and MT-ATP6 genes complicates gene-specific therapeutic approaches .

Recent international multicenter studies have begun addressing these challenges by providing retrospective natural history data and identifying potential clinical trial endpoints .

How might differential heteroplasmy levels across tissues influence the interpretation of MT-ATP8 variant pathogenicity?

Differential heteroplasmy levels across tissues create significant complexity in interpreting MT-ATP8 variant pathogenicity:

  • Tissue-specific thresholds: Different tissues may have varying threshold levels of heteroplasmy required to manifest clinical symptoms, complicating the correlation between genetic findings and clinical presentation .

  • Sampling limitations: Heteroplasmy levels measured in accessible tissues (blood, urine) may not accurately reflect levels in more clinically relevant but less accessible tissues (brain, heart, muscle) .

  • Dynamic changes over time: Heteroplasmy levels can change over time in different tissues due to mitotic segregation and selective pressures, potentially explaining progressive disease courses .

  • Combined variant effects: In cases with multiple mtDNA variants, differential heteroplasmy of each variant across tissues may create unique combinatorial effects .

  • Nuclear genetic modifiers: Nuclear genetic background may influence the tissue-specific consequences of a given heteroplasmy level, further complicating interpretation .

Researchers should consider collecting samples from multiple tissues when possible and interpret heteroplasmy levels in the context of tissue-specific manifestations. The development of international standards for reporting heteroplasmy and correlating levels with clinical features would significantly advance the field .

What methodological approaches can distinguish MT-ATP8 dysfunction from other causes of mitochondrial ATP synthesis defects?

Distinguishing MT-ATP8 dysfunction from other causes of mitochondrial ATP synthesis defects requires a methodical, multi-faceted approach:

  • Molecular genetic analysis: Comprehensive sequencing of mitochondrial DNA with particular attention to MT-ATP8, including accurate heteroplasmy quantification across multiple tissues .

  • Biochemical profiling: Assessment of ATP synthesis rates in isolated mitochondria, with comparison to controls and other known causes of ATP synthesis defects .

  • Structural biology approaches: Using cryo-electron microscopy or other advanced imaging techniques to directly visualize ATP synthase structure and detect specific abnormalities in subunit 8 positioning .

  • Yeast complementation studies: Testing whether human wild-type MT-ATP8 can rescue phenotypes in yeast models with subunit 8 mutations, providing evidence for subunit 8-specific effects .

  • Blue native gel electrophoresis: Analysis of ATP synthase complex assembly and stability, which can distinguish between defects affecting different subunits .

  • Proteomics approaches: Comprehensive analysis of mitochondrial protein composition to detect compensatory changes specific to MT-ATP8 dysfunction .

  • Clinical phenotyping: Careful documentation of symptom patterns that align with known MT-ATP8-related phenotypes versus other mitochondrial disorders .

These approaches, when used in combination, can provide stronger evidence for MT-ATP8-specific dysfunction as opposed to defects in other components of the oxidative phosphorylation system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.