Recombinant Human ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of MT-ATP6

MT-ATP6 is encoded by the mitochondrial genome and forms an essential component of the ATP synthase complex (Complex V) in the mitochondrial inner membrane. This protein plays a crucial role in the final step of oxidative phosphorylation, the process by which mitochondria convert energy from food into adenosine triphosphate (ATP), the cell's main energy source . The MT-ATP6 gene provides instructions for making a protein subunit that facilitates the controlled flow of protons across the inner mitochondrial membrane, which is essential for ATP production .

Within the ATP synthase complex, MT-ATP6 (also referred to as subunit a) forms part of the membrane-embedded domain that creates a pathway for protons to move from the intermembrane space into the mitochondrial matrix . This proton movement generates the energy needed to drive ATP synthesis in the catalytic domain of the complex . The protein's strategic position within the complex makes it indispensable for efficient energy conversion in all human cells.

Expression Systems

The production of recombinant MT-ATP6 presents unique challenges due to its hydrophobic properties and mitochondrial origin. Several expression platforms have been developed to overcome these obstacles:

  1. Cell-free protein synthesis (CFPS): This approach has proven effective for producing recombinant MT-ATP6, utilizing lysates from organisms such as Nicotiana tabacum that contain the necessary machinery for protein expression without cellular constraints . This system is particularly valuable for membrane proteins like MT-ATP6 that might disrupt cell viability when overexpressed.

  2. Bacterial expression: While not specifically documented for MT-ATP6 in all search results, E. coli systems have been successfully employed for producing other mitochondrial proteins with careful optimization of growth conditions and expression parameters .

  3. Eukaryotic expression: Advanced eukaryotic systems may provide more native-like post-translational modifications for mitochondrial proteins, though these systems generally have lower yields than bacterial or cell-free approaches.

Purification and Quality Assessment

Recombinant MT-ATP6 typically incorporates affinity tags to facilitate purification from the expression system. Common tags include:

  • Strep-Tag: Used for selective binding to engineered streptavidin matrices, allowing efficient one-step purification

  • Histidine tags: N-terminal 6xHis tags can be employed for metal affinity chromatography, similar to other mitochondrial proteins

Quality assessment of purified recombinant MT-ATP6 usually involves:

  • SDS-PAGE analysis to determine purity (typically >90% for research applications)

  • Western blotting to confirm protein identity and integrity

  • Functional assays to verify proper folding and activity when incorporated into membrane systems

Functional Significance in ATP Synthesis

MT-ATP6 serves as a critical component of the proton channel within ATP synthase. This channel allows positively charged hydrogen ions (protons) to flow across the specialized inner membrane of mitochondria . The energy released by this proton movement drives the rotation of another segment of the enzyme complex, which catalyzes the conversion of adenosine diphosphate (ADP) to ATP .

The ATP synthase in human mitochondria is a complex assembly of 29 proteins of 18 different kinds, organized into distinct functional modules: the F1-catalytic domain, the peripheral stalk (PS), and the c8-rotor ring . Within this intricate molecular machine, MT-ATP6 occupies a strategic position at the interface between the rotor and stator elements.

MT-ATP6 contains amino acid residues that form part of the proton translocation pathway, facilitating the controlled movement of protons that drives ATP synthesis . Specific residues within the protein create a hydrophilic pathway through the otherwise hydrophobic membrane domain, allowing protons to pass through in a manner coupled to the rotation of the c8-ring .

Pathogenic Variants

Mutations in the MT-ATP6 gene have been identified in patients with various neurological disorders. Among these, the most well-documented association is with Leigh syndrome, a progressive brain disorder that typically appears in infancy or early childhood . Approximately 10% of individuals with Leigh syndrome carry mutations in this gene .

Table 1: Selected MT-ATP6 Variants and Their Effects on ATP Synthase Function

Nucleotide ChangeAmino Acid ChangeFunctional ImpactDisease Association
m.8843T>Cp.I106TMinimal effectVarious disorders
m.8950G>Ap.V142ISignificant compromise of ATP synthaseMitochondrial disease
m.9016A>Gp.I164VMinimal effectVarious disorders
m.9025G>Ap.G167SSignificant compromise of ATP synthaseMitochondrial disease
m.9029A>Gp.H168RSignificant compromise of ATP synthaseMitochondrial disease
m.9058A>Gp.T178AMinimal effectVarious disorders
m.9139G>Ap.A205TMinimal effectVarious disorders
m.9160T>Cp.Y212HMinimal effectVarious disorders
T8993GVariousImpairs function/stability of ATP synthaseLeigh syndrome

Data compiled from references and

Molecular Mechanisms of Pathogenicity

Mutations in MT-ATP6 can disrupt ATP synthase function through several mechanisms:

  1. Impaired proton translocation: Certain amino acid substitutions alter the proton channel structure, reducing the efficiency of proton movement across the membrane .

  2. Destabilization of protein structure: Some mutations affect protein folding or stability, compromising the integrity of the ATP synthase complex .

  3. Disturbed assembly: Certain variants interfere with the integration of MT-ATP6 into the larger ATP synthase complex, disrupting the intricate assembly process .

  4. Reduced ATP production: The cumulative effect of these molecular disruptions is decreased ATP synthesis, particularly affecting tissues with high energy demands such as the brain, muscles, and heart .

Model Systems for Variant Assessment

The evaluation of MT-ATP6 variants' pathogenicity has been facilitated by model systems, particularly yeast models. The strong evolutionary conservation of mitochondrial proteins allows researchers to introduce human MT-ATP6 variants into yeast and assess their functional consequences . Studies utilizing such models have demonstrated that variants causing severe clinical phenotypes typically disrupt ATP synthase function more dramatically than those associated with milder conditions .

Disease Modeling and Therapeutic Development

Recombinant forms of MT-ATP6 carrying disease-associated mutations serve as important tools for:

  1. In vitro assays to assess functional consequences of specific mutations

  2. Screening potential therapeutic compounds that might restore function to mutated proteins

  3. Developing antibodies or other detection methods for diagnostic applications

The ability to produce recombinant MT-ATP6 with specific mutations enables detailed investigation of how these changes affect protein function, potentially leading to targeted therapeutic approaches for mitochondrial disorders.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please specify your preference when placing the order. We will prepare the product based on your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MNENLFASFIAPTILGLPAAVLIILFPPLLIPTSKYLINNRLITTQQWLIKLTSKQMMTM HNTKGRTWSLMLVSLIIFIATTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGTVIMGFRSK IKNALAHFLPQGTPTPLIPMLVIIETISLLIQPMALAVRLTANITAGHLLMHLIGSATLA MSTINLPSTLIIFTILILLTILEIAVALIQAYVFTLLVSLYLHDNT
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) generates ATP from ADP in the presence of a proton gradient across the membrane. This gradient is established by electron transport complexes within the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are interconnected by a central stalk and a peripheral stalk. During catalysis, ATP synthesis within the catalytic domain of F(1) is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This subunit is a key component of the proton channel and may play a direct role in proton translocation across the membrane.
Gene References Into Functions
  1. Somatic mutations in the ATP6 and/or ND3 genes were not identified in postmenopausal Mexican-Mestizo women with breast cancer PMID: 29414393
  2. A mutation in the mitochondrial ATP6 gene, G8969>A, was identified in a patient with IgA nephropathy. This mutation leads to the replacement of a highly conserved serine residue at position 148 of the a-subunit of ATP synthase. Increasing the mutation load in cybrid cell lines was associated with abnormal mitochondrial morphologies, diminished respiration, and enhanced production of reactive oxygen species. PMID: 27812026
  3. The study screened the MT-ATP6 and SURF1 genes in Tunisian patients with classical Leigh syndrome. The computational investigation of the detected mutations on its structure and functions was carried out using clinical and bioinformatics analyses. PMID: 29481804
  4. Mitochondrial ATP synthase mutations, which accumulate during the carcinogenesis process, may be significant in cancer cell escape from apoptosis. PMID: 28986220
  5. Interaction between mitochondrially encoded ATP synthase 6 (p.MT-ATP6) subunit and environmental exposure to the ATP synthase inhibitor tributyltin chloride might contribute to the etiology of striatal necrosis syndromes. PMID: 27129022
  6. A novel frameshift mutation in the mitochondrial ATP6 gene was identified in a 4-year-old girl with ataxia, microcephaly, developmental delay, and intellectual disability. PMID: 28412374
  7. Three mutations in the MT-ATP6 gene were associated with mitochondrial cardiomyopathy. PMID: 28104394
  8. ATP6 genetic polymorphisms were associated with breast cancer in the Mizoram mongloid population. PMID: 25896597
  9. Genetic variants were not associated with aggressive prostate cancer in overweight or obese Mexicans PMID: 27187822
  10. The study analyzed mitochondrial deletion and double mutations in the MT-ATP6 gene in Tunisian patients. PMID: 26993169
  11. Two synonymous substitutions (mt.8614T>C and mt.8994G>A) in the mt-ATP6 gene may be associated with childhood obesity. The study provides the first data about mitochondrial genome variations in a Turkish obese population, including obese children. PMID: 25541891
  12. This study suggests that, in part, polymorphisms in the MT-ATP6 and MT-CYB genes may contribute to unexpected fertilization failure. PMID: 24102627
  13. The T8821G mutation of the ATPase6 gene is associated with Leber's hereditary optic neuropathy. PMID: 26252090
  14. Screening of the MT-ATP6 gene in a large collection of patients suspected of suffering different mitochondrial DNA (mtDNA) disorders identified three new pathologic mutations. Biochemical, molecular-genetics, and other analyses confirmed these findings. PMID: 24986921
  15. This report focuses on a neonate with the m.8993 T>G mutation, emphasizing the implications of mtDNA disorders on family planning decisions. PMID: 25009317
  16. Five mutations that could change amino acid synthesis for the ATP synthase subunit 6 were associated with acute lymphoblastic leukemia in a Saudi Arabian cohort. PMID: 25556488
  17. The study identified 8 changes in the ATP6 gene in 36/50 examined breast cancer cell samples and 5 changes in the ATP8 gene (10/50). Most were homoplasmic changes of missense type. Four changes (A8439C, G8858C, C9130G, and T9119G) were previously unreported in the literature. PMID: 25110199
  18. The absence of Atp6 (F0-a) alters the structure but not the content of ATP synthase. PMID: 25588698
  19. A case report highlighted the absence of mtDNA-encoded ATPase6 and ATPase8 genes in a progressive external ophthalmoplegia patient. This absence clearly resulted in aberrant synthesis of ATP synthase. PMID: 20082143
  20. Patients with irritable bowel syndrome with diarrhea have a higher incidence of MT-ATP 6 and 8 polymorphisms than healthy subjects, suggesting that mtDNA polymorphism may play a role in irritable bowel syndrome with diarrhea. PMID: 23840124
  21. Mutations in mitochondrial DNA MT-ATP6/8 genes may be responsible for acute episodes of limb weakness. PMID: 24153443
  22. This study reports the second known family with a rare, maternally inherited missense m.8851T>C mutation in the mitochondrial MTATP6 gene. Novel laboratory and muscle biopsy findings in the patient and a new clinical presentation in her mother were observed. PMID: 23206802
  23. The findings reveal that an axonal Charcot Marie Tooth phenotype can be associated with mutations in the mitochondrial ATP6 gene PMID: 22971232
  24. Data demonstrated that mtDNA mutations within the ATPase6 gene are a frequent occurrence in Chinese patients with osteosarcoma. PMID: 22542792
  25. A family member with the m.8993T>C mutation in the mitochondrial MT-ATP6 gene exhibited neuropathy ataxia and retinitis pigmentosa/maternally inherited Leigh syndrome. PMID: 22819295
  26. The study demonstrated that m.9185T>C in MT-ATP6 causes Charcot-Marie-Tooth disease type 2 in 1.1% of genetically undefined cases. PMID: 22933740
  27. This study describes two families with adult-onset spinocerebellar ataxia due to mutations in MTATP6. PMID: 22577227
  28. Several genes expressed at exceptionally high levels were identified, associated with early oocyte development, including TMEFF2, the Rho-GTPase-activating protein oligophrenin 1 (OPHN1), and the mitochondrial-encoded ATPase6 (ATP6). PMID: 22238370
  29. A genetic study of Leigh syndrome identified a novel mutation at 8597T>C of the mitochondrial ATPase6 gene. PMID: 22348497
  30. Differences in the biosynthesis and remodeling of cardiolipin at the level of the inner mitochondrial transmembrane were related to some mutations of the ATP6 gene. PMID: 21993659
  31. A mitochondrial ATP6 point mutation was associated with a hereditary spastic paraplegia-like disorder. PMID: 20656066
  32. To understand the primary pathogenic mechanisms induced by mtDNA Atp6p T9176C, researchers investigated the consequences of this mutation on the ATP synthase of yeast, where Atp6p is also encoded by the mtDNA. PMID: 20056103
  33. ATPase6 gene nucleotide alterations and elevated Reactive Oxygen Species levels occur in idiopathic cases of Primary ovarian insufficiency (POI). PMID: 20361200
  34. The study reports a rare mutation, m. 9185 T>C, leading to a progressive but episodic pattern of neurological impairment with partial recovery in Leigh syndrome. PMID: 20546952
  35. Researchers demonstrated that a deficiency in ATP synthesis could be rescued by transferring MTATP6, a mitochondrial DNA-encoded gene, to the nucleus. PMID: 11925565
  36. ATP6L is upregulated in response to antineoplastic agents as an anti-apoptotic defense. PMID: 12133827
  37. A mitochondrial DNA microdeletion removes the termination codon for MTATP6 and sets MTCO3 immediately in frame. PMID: 12915481
  38. Mitochondrial ATP6 can utilize GUG as a functional initiation codon. PMID: 14697245
  39. The study provides the first evidence that hyperpolarization of mitochondria may be a 'risk factor' for cells with a severe ATPase dysfunction, such as cells from patients with maternally-inherited Leigh syndrome. PMID: 15228605
  40. 25 amino acids are likely the human-specific adaptation residues of ATP6. PMID: 15965056
  41. The data highlights the spectrum of mutations causing Leigh syndrome and emphasizes the role of MTATP6 gene mutations in the pathogenesis of Leigh syndrome. PMID: 16217706
  42. The data also demonstrate that mutations in either of these genes may cause early deafness and highlight the importance of genetic screening for recessive forms of dRTA independent of hearing status. PMID: 16611712
  43. Hybrid ATP6 mRNAs, similar to the endogenous SOD2 mRNA, localize to the mitochondrial surface in human cells. PMID: 16751614
  44. ATP synthase dimers and higher homo-oligomers were observed for the first time, and it was demonstrated that the mutant enzymes retain enough structural integrity to oligomerize. PMID: 17121862
  45. Reliability of preimplantation genetic diagnosis for the T8993G mutation was investigated. PMID: 17342424
  46. These results possibly highlight the distinct pathogenic mechanism generated by the two mutations at position 8993 of the ATPase 6 subunit of the mitochondrial ATP synthase complex. PMID: 17568559
  47. Point mutations occurring in mtDNA might be involved in the pathogenesis of multiple sclerosis. PMID: 17619138
  48. In a 3-generation ataxic family with the m.8993T-->C mutation of mtDNA, one member exhibited episodic ataxia and transient hemipareses, broadening the phenotype. No further cases were identified in an additional cohort of 191 patients with suspected EA. PMID: 18055910
  49. The mitochondrial 12S/MT-RNR1, MT-CO2/COX2, and MT-ATP6 transcripts are significantly decreased in prostate tumor samples. PMID: 18409190
  50. This paper emphasizes the role of MTATP6 in LS and expands the associated clinical phenotype further. PMID: 18461509

Show More

Hide All

Database Links

HGNC: 7414

OMIM: 256000

KEGG: hsa:4508

STRING: 9606.ENSP00000354632

Involvement In Disease
Neuropathy, ataxia, and retinitis pigmentosa (NARP); Leber hereditary optic neuropathy (LHON); Leigh syndrome (LS); Mitochondrial infantile bilateral striatal necrosis (MIBSN); Mitochondrial complex V deficiency, mitochondrial 1 (MC5DM1); Myopathy, lactic acidosis, and sideroblastic anemia 3 (MLASA3); Ataxia and polyneuropathy, adult-onset (APAO); Cardiomyopathy, infantile hypertrophic (CMHI)
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ATP6 and what is its primary function in cellular metabolism?

MT-ATP6 (Mitochondrially Encoded ATP Synthase Membrane Subunit 6) is a protein-coding gene located in the mitochondrial genome. It encodes the a-subunit (subunit 6) of the F0 portion of mitochondrial ATP synthase (Complex V). This protein functions as a key component of the proton channel within the membrane domain of ATP synthase, playing a direct role in proton translocation across the inner mitochondrial membrane .

The primary function of MT-ATP6 is to contribute to ATP synthesis through a rotary mechanism. Specifically, it facilitates proton transport across the mitochondrial membrane, which generates the electrochemical gradient necessary for ATP production. The proton gradient created by electron transport complexes powers the rotation of ATP synthase, coupling proton movement to ATP synthesis in the catalytic domain .

What are the established nomenclature and identifiers for MT-ATP6 in research databases?

Table 1: MT-ATP6 Nomenclature and Database Identifiers

CategoryIdentifierReference
Primary SymbolMT-ATP6
Common AliasesATP6, MTATP6, ATPase-6, Su6m
HGNC ID7414
NCBI Gene ID4508
EnsemblENSG00000198899
OMIM®516060
UniProtKB/Swiss-ProtP00846
Previous HGNC SymbolsMTATP6, RP

Researchers should use consistent nomenclature when referencing MT-ATP6 in publications to maintain clarity across the literature. The HGNC-approved symbol MT-ATP6 is currently preferred over older designations such as MTATP6 .

How does MT-ATP6 contribute to the structure and assembly of ATP synthase?

MT-ATP6 is a critical component of the membrane-embedded F0 domain of ATP synthase (Complex V). The protein plays an essential structural role by forming part of the proton channel through which hydrogen ions flow during oxidative phosphorylation .

ATP synthase consists of two primary structural domains: F1 (containing the extramembraneous catalytic core) and F0 (containing the membrane proton channel). These domains are connected by central and peripheral stalks that facilitate the mechanical coupling between proton translocation and ATP synthesis .

Within this complex architecture, MT-ATP6 is positioned strategically to enable proton movement across the inner mitochondrial membrane. Assembly studies in yeast models have demonstrated that incorporation of ATP6 (the yeast homolog) occurs at a late stage in the assembly process of ATP synthase, after the formation of intermediate subcomplexes . The proper assembly of MT-ATP6 is crucial for the structural integrity and functional capacity of the entire ATP synthase complex.

What methodologies can effectively measure MT-ATP6 assembly into functional ATP synthase complexes?

Several complementary techniques can assess the incorporation of MT-ATP6 into functional ATP synthase complexes:

  • Blue-Native Gel Electrophoresis (BN-PAGE): This technique separates intact protein complexes according to their size while preserving their native state. In patients with MT-ATP6 mutations, BN-PAGE of cultured fibroblasts and skeletal muscle tissue reveals multiple bands, indicating impaired Complex V assembly . The technique can identify both fully assembled ATP synthase and assembly intermediates.

  • Microscale Oxygraphy: This method measures oxygen consumption rates in intact cells or isolated mitochondria, providing data on basal respiration, ATP synthesis capacity, and respiratory reserve. Studies of cells with MT-ATP6 mutations show reduced basal respiration and ATP synthesis .

  • Assembly-Dependent Translation Analysis: Research in yeast models demonstrates that the rate of translation of ATP6 is influenced by the assembly state of the complex. Experimental approaches using pulse-labeling of mitochondrial translation products can track the synthesis and incorporation of newly synthesized ATP6 into the complex .

  • Reactive Oxygen Species (ROS) Measurement: Impaired assembly of ATP synthase due to MT-ATP6 mutations often results in increased ROS generation, which can be quantified using fluorescent probes specific for mitochondrial ROS .

What is the spectrum of clinical phenotypes associated with MT-ATP6 mutations?

MT-ATP6 mutations are associated with a remarkably diverse range of clinical manifestations, reflecting the critical role of ATP synthase in cellular energy production across multiple tissues. The phenotypic spectrum includes:

When characterizing novel MT-ATP6 variants, a multi-faceted approach is essential:

  • Transmitochondrial Cybrid Cell Studies: This technique involves transferring mitochondria from patient cells into cells lacking mtDNA (ρ0 cells), creating cybrid (cytoplasmic hybrid) cell lines. This approach isolates the effects of mtDNA mutations from the nuclear genetic background, allowing direct assessment of pathogenicity. This method has successfully confirmed the deleterious effects of novel mutations like m.8782G>A; p.(Gly86*) .

  • Heteroplasmy Assessment Across Tissues: Due to the variable distribution of mutant mtDNA across different tissues, comprehensive assessment requires sampling multiple tissue types. Studies show that truncating MT-ATP6 mutations may exhibit highly variable mutant levels across tissues, which has important implications for genetic counseling .

  • Functional Biochemical Testing:

    • Measurement of basal respiration and ATP synthesis using microscale oxygraphy

    • Assessment of ROS generation

    • Analysis of Complex V assembly using BN-PAGE

    • Measurement of mitochondrial membrane potential

  • Variant Curation and Database Submission: Expert curation of MT-ATP6 variants improves understanding and consistency of allele pathogenicity assessment. Characterized variants should be deposited in community resources such as ClinVar and MSeqDR .

How does heteroplasmy influence the expression and severity of MT-ATP6-related disorders?

Heteroplasmy—the coexistence of wild-type and mutant mtDNA molecules within the same cell—is a critical factor influencing the expression and severity of MT-ATP6-related disorders. The threshold effect hypothesis suggests that clinical symptoms manifest only when the proportion of mutant mtDNA exceeds a tissue-specific threshold.

Research findings demonstrate that:

  • Tissue Variability: All three probands in a recent study demonstrated a broad range of heteroplasmy across different tissue types . This variability explains the diverse organ involvement seen in MT-ATP6-related disorders.

  • Threshold Effects: Different tissues have varying thresholds for biochemical defects and clinical manifestations. Tissues with high energy demands (brain, retina, kidney) may manifest symptoms at lower heteroplasmy levels compared to other tissues.

  • Disease Progression: Changes in heteroplasmy levels over time may contribute to disease progression. Tissues may accumulate higher levels of mutant mtDNA through relaxed replication or selective pressures.

  • Genetic Counseling Implications: The variable distribution of heteroplasmy across tissues has significant implications for genetic counseling, as sampling a single tissue type may not accurately represent the mutational burden in other tissues .

Methodologically, accurate heteroplasmy quantification requires next-generation sequencing approaches with high depth of coverage or other sensitive techniques like pyrosequencing or digital droplet PCR.

What regulatory mechanisms control MT-ATP6 expression in mitochondria?

The regulation of MT-ATP6 expression involves sophisticated mechanisms that ensure proper stoichiometry of ATP synthase components despite their dual genetic origin (nuclear and mitochondrial):

  • Assembly-Dependent Translation: Research in yeast mitochondria reveals that the rate of translation of ATP6 is enhanced in strains with mutations leading to specific defects in the assembly of these proteins . This suggests a feedback loop where assembly intermediates influence the translation rate of ATP6.

  • cis-Regulatory Sequences: Expression of MT-ATP6 is controlled by cis-regulatory sequences within the mitochondrial genome. These sequences respond to the assembly state of the ATP synthase complex .

  • Coordinated Nuclear and Mitochondrial Expression: The assembly of ATP synthase requires coordinated expression of nuclear-encoded and mitochondrially-encoded subunits. This coordination involves communication between the two genomes to maintain proper stoichiometry.

  • Prevention of Harmful Intermediates: Assembly-dependent feedback loops are presumed important to limit the accumulation of harmful assembly intermediates that could dissipate the mitochondrial membrane electrical potential .

What experimental approaches are most effective for studying MT-ATP6 function in disease models?

What are the current best practices for molecular diagnosis of MT-ATP6-related disorders?

Given the phenotypic heterogeneity of MT-ATP6-related disorders, a comprehensive diagnostic approach is recommended:

  • Multi-Tissue Sampling: Due to tissue-specific heteroplasmy, sampling multiple tissues increases diagnostic yield. Blood, urine sediment, buccal cells, and when available, muscle tissue should be considered .

  • Next-Generation Sequencing: Whole mitochondrial genome sequencing using NGS technology with high depth of coverage allows for accurate detection of variants and precise heteroplasmy quantification.

  • Functional Validation: Given the increasing recognition of variants of uncertain significance (VUS), functional validation of novel variants is essential:

    • Transmitochondrial cybrid studies

    • Biochemical assessment of ATP synthase function

    • Blue-native gel electrophoresis to assess complex assembly

  • Integration with Clinical Data: Interpretation of molecular findings must be integrated with clinical, histological, and biochemical data for accurate diagnosis.

  • Expert Variant Curation: Involvement of experts in mitochondrial genetics for variant interpretation and classification is recommended, with deposition of findings in community resources .

Recent research emphasizes that "the best diagnostic confirmatory approach is a multi-pronged one" that incorporates these various elements .

How can experimental findings regarding MT-ATP6 translate to therapeutic approaches?

While current treatment options for MT-ATP6-related disorders remain limited, research findings are guiding potential therapeutic strategies:

  • Targeting Mitochondrial Bioenergetics: Understanding the specific bioenergetic defects associated with MT-ATP6 mutations enables targeted approaches to improve ATP synthesis or reduce harmful ROS production.

  • Gene Therapy Approaches: Recent advances in delivering genetic material to mitochondria offer potential for correcting or bypassing MT-ATP6 defects.

  • Heteroplasmy Shifting: Approaches that selectively reduce mutant mtDNA levels might be effective for MT-ATP6 disorders, given the significant impact of heteroplasmy on disease expression.

  • Pharmacological Interventions: Based on the observation of increased ROS generation in cells with MT-ATP6 mutations, antioxidant therapies might mitigate some disease manifestations .

  • Metabolic Bypass Strategies: Understanding the specific metabolic consequences of MT-ATP6 dysfunction could guide development of substrate-level phosphorylation enhancement strategies.

Translational research should focus on the specific cellular consequences of MT-ATP6 mutations, taking into account the tissue-specific manifestations and heteroplasmy thresholds observed in clinical studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.