Recombinant Human B-cell receptor-associated protein 31 (BCAP31)

Shipped with Ice Packs
In Stock

Description

Introduction

B-cell receptor-associated protein 31 (BCAP31), also known as BAP31, is a transmembrane protein predominantly found in the endoplasmic reticulum (ER), including mitochondria-associated membranes (MAMs) . In humans, BCAP31 is encoded by the BCAP31 gene . This protein functions as a chaperone and quality control factor, influencing the fate of its client proteins by facilitating ER retention, ER export, ER-associated degradation (ERAD), or evasion of degradation . BCAP31 also serves as a MAM tetherer and regulatory protein .

Gene and Protein Structure

The BCAP31 gene is located on the X chromosome at Xq28 . The protein encoded by this gene is a member of the B-cell receptor associated protein 31 superfamily . Recombinant Human BCAP31 consists of amino acids 2-243, with a theoretical molecular weight of 54.5 kDa .

Physiological Functions

BCAP31 is involved in several cellular processes :

  • ER and mitochondrial homeostasis

  • Promotion of cell proliferation and migration

  • Regulation of metabolism and immune system functions

  • Modulation of autophagy and apoptosis

  • Anterograde transport of membrane proteins from the ER to the Golgi apparatus

  • Quality control of ER-derived vesicles

  • Involved in the recognition of abnormally folded proteins and their targeting to ER-associated degradation (ERAD)

  • Cargo receptor for the export of transmembrane proteins

BCAP31 can be anti-apoptotic in its full-length form but can also mediate caspase-8 activation. Caspase-8 cleaves BCAP31 into p20-BAP31, which promotes apoptosis by mobilizing ER calcium stores at MAMs . It also forms a complex with TOMM40, which is involved in the translocation of mitochondrial membrane respiratory chain components .

Role in Diseases

Dysregulation of BCAP31 has been associated with autoimmune diseases, viral infections, and certain cancers . High BCAP31 expression levels have been linked to poor prognosis in several malignancies .

BCAP31 is associated with the following disorders:

  • Schimke XLID syndrome This syndrome results from a deletion in the BCAP31 gene .

  • Deafness, Dystonia, and Cerebral Hypomyelination (DDCH) Loss of function mutations in BCAP31 cause a severe X-linked phenotype characterized by deafness, dystonia, and central hypomyelination and disorganize the Golgi apparatus . Males are primarily affected by this disorder, presenting with severe intellectual disability, dystonia, deafness, and central hypomyelination .

BCAP31 as a Cancer Biomarker

BCAP31 expression is strongly associated with the tumor microenvironment (TME), influencing the levels of infiltrating immune cells, immune-related genes, and immune-related pathways . BCAP31 expression also impacts the outcomes and prognosis of cancer patients undergoing immunotherapy .

BCAP31 ELISA Kit

ELISA kits are available for detecting BCAP31 levels in human serum, plasma, and cell culture supernatants. These kits offer high sensitivity and specificity, making them valuable tools for studying BCAP31's role in human health and disease .

BCAP31 is expressed in various tissues and cell types. Expression data from The Cancer Genome Atlas (TCGA) and the Broad Institute Cancer Cell Line Encyclopedia (CCLE) databases indicates BCAP31 overexpression in several prevalent malignancies .

Interactions

BCAP31 interacts with several proteins, including :

  • VAMP3

  • VAMP1

  • Membrane IgD immunoglobulins

  • ACTG1

  • Non-muscle myosin II

  • HACD2

  • PTPLB

  • CASP8

  • BCL2

  • BCL2L1

It forms homodimers and heterodimers with BCAP29 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your convenience.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
6C6 AG; 6C6 AG tumor associated antigen; 6C6-AG tumor-associated antigen; 6C6AG; 6C6AG tumor associated antigen; Accessory protein BAP 31; Accessory protein BAP31; B cell receptor associated protein 31; B-cell receptor-associated protein 31; BA31; BAP 31; Bap31; BAP31_HUMAN; BCAP 31; BCAP31; BCR associated protein Bap 31; BCR associated protein Bap31; BCR-associated protein 31; CDM; CDM protein; DXS1357E; MS950; p28; p28 Bap31; Protein CDM; RP23-329M9.5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-246
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
SLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVL LVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVT LISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEEN RSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPM DKKEE
Uniprot No.

Target Background

Function
Recombinant Human B-cell receptor-associated protein 31 (BCAP31) functions as a chaperone protein, and is one of the most abundant proteins in the endoplasmic reticulum (ER). It plays a crucial role in the export of secreted proteins from the ER, recognition of misfolded proteins, and their targeting for ER-associated degradation (ERAD). It also serves as a cargo receptor for transmembrane protein export. Furthermore, BCAP31 participates in the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) by facilitating the translocation of NDUFS4 and NDUFB11 from the cytosol to the mitochondria through interaction with TOMM40. In response to ER stress, BCAP31 relocates from ER-mitochondria contact sites and binds BCL2. It may also be involved in CASP8-mediated apoptosis.
Gene References Into Functions
  1. BAP31 as a potential prognostic marker for colorectal cancer patients post-surgery. (PMID: 29653744)
  2. BAP31 expression as an independent prognostic factor for overall survival in hepatocellular carcinoma (HCC) patients post-surgery; low expression correlates with poor prognosis. (PMID: 25980696)
  3. Increased csBAP31 expression linked to poor survival in non-small cell lung cancer (NSCLC) cells. (PMID: 29145450)
  4. BCAP31-associated encephalopathy (DDCH syndrome) confirmed via whole exome sequencing in a patient presenting with clinical features suggestive of mitochondrial encephalopathy. (PMID: 28332767)
  5. Biochemical characterization of plant orthologs of human BAP31 (PBL proteins). (PMID: 27770627)
  6. Caspase-8-mediated cleavage of BAP31 triggering TRAIL-induced ER stress. (PMID: 26212606)
  7. Exposure of the C-terminal domain of BAP31 on the surface of human embryonic stem cells. (PMID: 26102500)
  8. Association of both BCAP31 and ABCD1 with hepatic cholestasis and mortality within one year; a similar severe phenotype observed in a patient with an isolated deletion at the 3'-end of SLC6A8. (PMID: 24597975)
  9. Co-localization and interaction of human respiratory syncytial virus SH protein with BAP31. (PMID: 25854864)
  10. Relevant findings. (PMID: 25044748)
  11. Regulation of human embryonic stem cell stemness and survival by BAP31 via control of EpCAM expression. (PMID: 24898727)
  12. Association of BCAP31 hypomethylation with breast cancer. (PMID: 24395279)
  13. Impact of BAP31 deficiency on ER metabolism and the Golgi apparatus, highlighting its role in ER-to-Golgi communication. (PMID: 24011989)
  14. Essential role of BAP31 and BiP in the dislocation of SV40 from the ER to the cytosol. (PMID: 21947079)
  15. Association of MARCH VIII and MARCH IV with Bap31, targeting CD81 and CD44 to lysosomes. (PMID: 21151997)
  16. Role of Fis1 and Bap31 in bridging the mitochondria-ER interface for apoptosis induction. (PMID: 21183955)
  17. Contiguous deletion of ABCD1 and DXS1357E, resulting in a neonatal phenotype similar to peroxisomal biogenesis disorders. (PMID: 11992258)
  18. Induction of mitochondrial fission by the CASP8 cleavage product of BAP31 via ER calcium signals, enhancing cytochrome c release. (PMID: 12668660)
  19. Identification of a novel BAP31-interacting protein: a member of the PTPLB family. (PMID: 15024066)
  20. Generation of proapoptotic BAP20 from BAP31 cleavage, potentially mediating mitochondrion-ER crosstalk via a Ca(2+)-dependent mechanism. (PMID: 15254227)
  21. Potential role of BAP31 in regulating intracellular trafficking of CD11b/CD18 in neutrophils. (PMID: 15294914)
  22. Regulation of ER-stress-mediated apoptosis by calnexin through Bap31 binding, independent of its chaperone function. (PMID: 16858427)
  23. Quality control of class I molecules by Bap31 in two phases: exporting peptide-loaded molecules and retrieving peptide-lost molecules. (PMID: 17056546)
  24. Bap31 as a component of the ER quality control compartment, moving between the peripheral ER and a juxtanuclear ER-related compartment. (PMID: 18287538)
  25. Promotion of retrotranslocation and proteasomal degradation of the DeltaF508 mutant of CFTR by Bap31. (PMID: 18555783)
  26. Identification of BAP31 as a binding partner of high-risk HPV16 E5 proteins, providing insight into E5 protein modulation of the viral life cycle. (PMID: 18684816)
Database Links

HGNC: 16695

OMIM: 300398

KEGG: hsa:10134

STRING: 9606.ENSP00000392330

UniGene: Hs.522817

Involvement In Disease
Deafness, dystonia, and cerebral hypomyelination (DDCH)
Protein Families
BCAP29/BCAP31 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous. Highly expressed in neurons and discrete endocrine cells.

Q&A

What is BCAP31 and what are its primary cellular functions?

BCAP31 (B-cell receptor-associated protein 31) is a widely expressed transmembrane protein primarily localized to the endoplasmic reticulum (ER), including ER-mitochondria associated membranes . The protein consists of 246 amino acids with distinct functional domains, including transmembrane regions that anchor it to the ER membrane . Functionally, BCAP31 plays critical roles in protein trafficking, ER-associated degradation (ERAD), apoptotic regulation, and cellular stress responses. It facilitates the transport of newly synthesized membrane proteins and acts as a quality control checkpoint, identifying misfolded proteins for degradation. Additionally, BCAP31 participates in apoptotic signaling through interactions with caspases and Bcl-2 family proteins, making it a key player in determining cell fate during stress conditions.

How do post-translational modifications affect BCAP31 function?

Post-translational modifications significantly influence BCAP31's functional roles. Phosphorylation of specific serine and threonine residues alters BCAP31's interaction with binding partners and can modify its role in protein trafficking. During apoptotic events, BCAP31 undergoes caspase-mediated cleavage, generating a p20 fragment that influences mitochondrial calcium flux and enhances cell death signaling . The regulation of these modifications is context-dependent, with different cellular stresses triggering specific modification patterns. For experimental assessment, phospho-specific antibodies and site-directed mutagenesis approaches have been valuable in characterizing how these modifications impact BCAP31's diverse cellular functions.

What protein-protein interactions are critical for BCAP31's cellular activities?

BCAP31 participates in numerous protein-protein interactions that are essential for its functions. It interacts with nascent membrane proteins, acting as a chaperone during their transport through the secretory pathway. Key interactions include associations with cytosolic coat proteins involved in vesicular transport, as well as with ER-resident chaperones that aid in protein folding. During apoptotic signaling, BCAP31 interacts with Bcl-2 family proteins and caspases, particularly caspase-8 . Additionally, its role in immune function involves interactions with major histocompatibility complex (MHC) class I molecules. These interactions can be studied using co-immunoprecipitation, proximity ligation assays, and fluorescence resonance energy transfer (FRET) techniques to elucidate the complex network of BCAP31's interacting partners under different cellular conditions.

What are the most effective methods for detecting BCAP31 expression in tissue samples?

For detecting BCAP31 expression in tissue samples, immunohistochemistry (IHC) has proven highly effective, as demonstrated in studies examining BCAP31 expression across various cancer types . When performing IHC, optimal results are achieved using formalin-fixed, paraffin-embedded sections with heat-induced epitope retrieval. Western blotting provides quantitative assessment of BCAP31 protein levels, with recommended protein loading of 20-50μg per lane and overnight primary antibody incubation at 4°C . For mRNA detection, quantitative RT-PCR using specific primers targeting conserved regions of the BCAP31 transcript offers high sensitivity. RNA-seq analysis has also been valuable for examining BCAP31 expression patterns across large datasets, as evidenced by studies utilizing TCGA and CCLE databases . When comparing expression between tumor and normal tissues, it's critical to include matched adjacent normal samples whenever possible to account for patient-specific variations.

How can BCAP31 be successfully knocked down in cell culture models?

Effective BCAP31 knockdown in cell culture models has been achieved using siRNA-mediated approaches, as demonstrated in studies with KYSE-150 cells . For optimal transfection, lipid-based reagents typically yield high efficiency with minimal cytotoxicity. The recommended protocol involves seeding cells at 60-70% confluency, followed by transfection with 20-50nM siRNA. Multiple siRNA sequences targeting different regions of the BCAP31 transcript should be tested to identify the most effective construct . Knockdown efficiency should be verified at both the mRNA level (24-48 hours post-transfection) using qRT-PCR and at the protein level (48-72 hours post-transfection) using Western blotting . For stable knockdown, lentiviral-based shRNA systems provide long-term suppression, which is particularly valuable for extended functional studies and in vivo experiments. CRISPR-Cas9 gene editing represents an alternative approach for complete BCAP31 knockout, though careful validation is necessary to confirm specificity and rule out off-target effects.

What functional assays are most informative for studying BCAP31's cellular roles?

Several functional assays have proven particularly informative for characterizing BCAP31's cellular roles:

  • Proliferation assays: MTT assays have effectively demonstrated BCAP31's impact on cell viability and proliferation in cancer cell lines . The recommended protocol involves seeding 3-5×10³ cells per well in 96-well plates and measuring absorbance at 490nm at multiple time points over 96 hours.

  • Migration and invasion assays: Transwell and wound healing assays have revealed BCAP31's influence on cell motility and invasive capacity . For Transwell assays, 5×10⁴ cells/mL should be seeded in serum-free medium in the upper chamber, with FBS-containing medium in the lower chamber as a chemoattractant .

  • Colony formation assays: This approach assesses long-term proliferative potential, with recommended seeding of 500 cells per well in 6-well plates and culture for 2 weeks before fixation and crystal violet staining .

  • Apoptosis assays: Flow cytometry with Annexin V/PI staining can quantify BCAP31's effect on apoptotic pathways.

  • ER stress response assays: Monitoring of ER stress markers (BiP, CHOP, XBP1 splicing) following BCAP31 manipulation provides insights into its role in ER homeostasis.

Each assay should include appropriate controls, with triplicates for statistical validation, and experiments should be independently repeated at least three times to ensure reproducibility .

How does BCAP31 expression vary across different cancer types?

Pan-cancer analysis reveals significant variation in BCAP31 expression across cancer types. Using data from TCGA and other databases, researchers have found elevated BCAP31 expression in multiple malignancies compared to corresponding normal tissues . Specifically, Western blot analysis has confirmed increased BCAP31 expression in esophageal squamous cell carcinoma (ESCA), lung adenocarcinoma (LUAD), and gastric adenocarcinoma (GA) compared to adjacent normal tissues . Immunohistochemistry of tissue samples further validated these findings, showing consistently higher BCAP31 protein levels in tumor tissues .

The expression pattern varies significantly by cancer type:

  • Highest expression: Esophageal cancer, liver hepatocellular carcinoma, head and neck squamous cell carcinoma

  • Moderate expression: Breast cancer, colorectal cancer, lung adenocarcinoma

  • Variable expression: Ovarian cancer (OV), paraganglioma and pheochromocytoma (PCPG), and sarcoma (SARC) showed no significant difference between tumor and normal tissues

These differences suggest tissue-specific regulatory mechanisms controlling BCAP31 expression and potentially distinct roles in different tumor microenvironments.

What mechanisms explain BCAP31's role in cancer progression?

Multiple mechanisms underlie BCAP31's contribution to cancer progression:

  • Regulation of cell survival pathways: BCAP31 influences apoptotic signaling through interactions with Bcl-2 family proteins, potentially conferring resistance to cell death in cancer cells .

  • Impact on cellular migration and invasion: Knockdown studies in KYSE-150 cells demonstrated that BCAP31 significantly affects migration and invasion capabilities, with BCAP31-silenced cells showing reduced motility in Transwell and wound healing assays .

  • Modulation of proliferative capacity: MTT assays revealed decreased cell viability following BCAP31 knockdown, indicating its role in sustaining proliferation . Conversely, BCAP31 knockdown promoted colony formation abilities in some contexts, suggesting complex, context-dependent effects on cell growth .

  • Influence on tumor microenvironment: BCAP31 expression correlates with immune infiltration patterns and stromal components, potentially shaping the tumor microenvironment to favor progression . Analysis using the ESTIMATE computational method revealed significant correlations between BCAP31 expression and tumor purity, immune scores, and stromal scores across various cancer types .

  • Genomic alterations: Copy number variations (CNV) analysis showed associations between BCAP31 CNVs and its mRNA expression levels, suggesting genomic alterations as one mechanism driving aberrant BCAP31 expression in tumors .

These diverse mechanisms highlight BCAP31's multifaceted role in cancer progression and its potential as a therapeutic target.

How does BCAP31 influence cancer patient prognosis?

The prognostic relevance varies by survival metric:

Interestingly, in some cancer types (ovarian cancer, thyroid carcinoma, sarcoma, and stomach adenocarcinoma), BCAP31 downregulation was associated with worse outcomes, indicating context-dependent prognostic significance . These findings suggest that BCAP31 expression could serve as a valuable prognostic biomarker, though its utility may vary by cancer type and specific clinical context.

How does BCAP31 expression correlate with immune cell infiltration in tumors?

BCAP31 expression shows significant correlations with immune cell infiltration across various cancer types. Analysis using ImmueCellAI and TIMER2 databases revealed distinct patterns of association between BCAP31 expression and different immune cell populations .

Positive correlations were observed between BCAP31 expression and several immune cell types:

  • Neutrophils

  • Dendritic cells (DC)

  • Effector memory T cells (Tem)

  • Macrophages

  • Monocytes

  • Natural Treg cells (nTreg)

  • Th17 cells

  • Natural killer T cells (NKT)

Negative correlations were found with:

  • γδ T cells (Tgd)

  • Cytotoxic T cells (Tc)

  • Type 1 regulatory T cells (Tr1)

  • CD8+ T cells

  • Natural killer cells (NK)

  • Induced Treg cells (iTreg)

  • Central memory T cells (Tcm)

  • B cells

  • Follicular helper T cells (Tfh)

  • CD4+ T cells

In the TCGA-ESCA cohort specifically, BCAP31 showed strong positive associations with Tem cells, neutrophils, monocytes, and dendritic cells, while negatively correlating with B cells, Tr1, Tfh, Tcm, Tc, NK, iTreg, CD8 T, and CD4 T cell subsets . These patterns suggest that BCAP31 may contribute to an immunosuppressive tumor microenvironment, potentially by recruiting myeloid cells while inhibiting cytotoxic lymphocyte functions. This immune modulation could represent one mechanism by which BCAP31 influences cancer progression and patient outcomes.

What is the relationship between BCAP31 and tumor microenvironment components?

Specifically:

  • Tumor purity: BCAP31 expression showed negative correlations with tumor purity in diffuse large B-cell lymphoma (DLBC), uveal melanoma (UVM), low-grade glioma (LGG), and glioblastoma multiforme (GBM) . This inverse relationship suggests that tumors with high BCAP31 expression may contain larger proportions of non-malignant stromal and immune cells.

  • Immune scores: Positive correlations were observed between BCAP31 expression and immune scores in DLBC, UVM, LGG, GBM, and ovarian cancer (OV) . This indicates that BCAP31-high tumors may harbor increased immune cell infiltration.

  • Stromal scores: BCAP31 expression showed significant correlations with stromal scores across multiple cancer types, with notable exceptions including OV, kidney renal papillary cell carcinoma (KIRP), uterine carcinosarcoma (UCS), sarcoma (SARC), cervical squamous cell carcinoma (CESC), and several others .

  • ESTIMATE scores: Significant correlations were found between BCAP31 expression and ESTIMATE scores (which combine immune and stromal components) in several cancer types, particularly DLBC, UVM, LGG, GBM, and OV .

These findings suggest that BCAP31 plays a critical role in shaping the TME composition, potentially influencing both stromal and immune compartments. The cancer type-specific variation in these relationships indicates context-dependent functions of BCAP31 in different tumor settings. Understanding these interactions could inform therapeutic strategies aimed at modulating the TME to enhance anti-tumor responses.

How might BCAP31 mechanistically influence immune responses in cancer?

BCAP31 appears to mechanistically influence immune responses in cancer through multiple pathways, though the precise mechanisms warrant further investigation. Based on correlation analyses with immune cell populations and functional studies, several potential mechanisms can be proposed:

  • Regulation of antigen presentation: Given BCAP31's known interactions with MHC class I molecules in the ER, it may influence antigen processing and presentation, affecting CD8+ T cell recognition of tumor cells.

  • Cytokine and chemokine modulation: The observed correlations between BCAP31 expression and specific immune cell populations suggest potential roles in regulating chemokine production or signaling that governs immune cell recruitment .

  • Myeloid cell polarization: The positive association between BCAP31 and myeloid-derived cells (neutrophils, monocytes, macrophages, DCs) suggests it may influence myeloid cell functions or polarization states, potentially promoting immunosuppressive phenotypes .

  • T cell subtype regulation: The negative correlations with effector T cell populations (CD8+, CD4+) and positive correlations with regulatory T cells (nTreg) indicate BCAP31 may contribute to suppressing cytotoxic immune responses while enhancing immunoregulatory pathways .

  • ER stress-mediated immune modulation: As an ER protein involved in cellular stress responses, BCAP31 may influence immunomodulatory pathways triggered by ER stress, which is common in the tumor microenvironment.

The pattern of immune cell correlations with BCAP31—positive associations with immunosuppressive cells and negative associations with cytotoxic effectors—suggests that BCAP31 may contribute to tumor immune evasion . These potential mechanisms provide a foundation for future studies investigating BCAP31 as a target for cancer immunotherapy approaches.

What therapeutic strategies could target BCAP31 or BCAP31-dependent pathways?

Several therapeutic strategies could potentially target BCAP31 or its dependent pathways based on current understanding of its functions:

  • Small molecule inhibitors: Developing small molecules that disrupt BCAP31's interactions with key binding partners could interfere with its pro-tumorigenic functions. Potential targets include the interfaces between BCAP31 and Bcl-2 family proteins or components of the protein trafficking machinery.

  • RNA interference approaches: siRNA or antisense oligonucleotides targeting BCAP31 mRNA could reduce its expression, similar to the knockdown approach that demonstrated anti-tumor effects in KYSE-150 cells . Advanced delivery systems like lipid nanoparticles could enhance the clinical applicability of this approach.

  • Peptide-based inhibitors: Designed peptides that mimic critical interaction domains of BCAP31 could competitively inhibit its function, particularly in protein-protein interactions that promote cancer cell survival or migration.

  • Targeted protein degradation: Proteolysis-targeting chimeras (PROTACs) or molecular glues could be designed to induce selective degradation of BCAP31 protein.

  • Combination therapies: Given the association between BCAP31 expression and drug sensitivity to various compounds including 5-Fluorouracil, ABT737, Afuresertib, and Alisertib, combining BCAP31 inhibition with these agents could enhance therapeutic efficacy .

  • Immunotherapeutic approaches: Since BCAP31 influences immune cell infiltration and potentially contributes to an immunosuppressive TME, combining BCAP31 inhibition with immune checkpoint inhibitors could enhance anti-tumor immune responses.

These approaches require further development and validation, but the multifaceted roles of BCAP31 in cancer biology suggest it could be a valuable therapeutic target, particularly in malignancies where its expression is elevated and associated with poor outcomes.

How might BCAP31 expression affect response to conventional cancer therapies?

BCAP31 expression levels appear to influence sensitivity to several conventional cancer therapies, suggesting its potential utility as a predictive biomarker for treatment response. Analysis using GDSC2 data revealed significant correlations between BCAP31 expression and drug sensitivity profiles:

  • Chemotherapeutic agents: High BCAP31 expression correlates with increased sensitivity to 5-Fluorouracil, a widely used antimetabolite in cancer treatment . This association may relate to BCAP31's involvement in cellular stress responses and apoptotic pathways.

  • Targeted therapies: Sensitivity to several targeted agents showed correlations with BCAP31 expression:

    • ABT737 (Bcl-2 inhibitor): BCAP31's interactions with Bcl-2 family proteins may explain this association

    • Afuresertib (AKT inhibitor): Suggests crosstalk between BCAP31 and AKT signaling pathways

    • AGI-5198 and AGI-6780 (mutant IDH1 and IDH2 inhibitors, respectively): Indicates potential relationships between BCAP31 and metabolic pathways

    • Alisertib (Aurora kinase inhibitor): Suggests links between BCAP31 and cell cycle regulation

  • Radiotherapy: While direct evidence is limited, BCAP31's roles in ER stress responses and apoptosis regulation suggest it could influence radiosensitivity.

  • Immunotherapy: Given BCAP31's associations with immune cell infiltration patterns, its expression might predict response to immune checkpoint inhibitors, though this requires further investigation .

These findings suggest that assessing BCAP31 expression could help stratify patients likely to benefit from specific therapeutic approaches. For clinical implementation, standardized methods for BCAP31 assessment would need to be established, along with defined expression thresholds for predicting treatment response.

What challenges exist in developing BCAP31-targeted therapies?

Developing effective BCAP31-targeted therapies faces several significant challenges:

  • Context-dependent functions: BCAP31's roles appear to vary across cancer types, with differential associations with prognosis observed in various malignancies . This heterogeneity complicates the development of broadly applicable therapeutic approaches and necessitates careful patient selection.

  • Protein localization: BCAP31's primary localization to the ER membrane presents accessibility challenges for therapeutic agents, particularly antibodies or large molecules that may not efficiently penetrate intracellular compartments.

  • Essential cellular functions: As BCAP31 participates in fundamental cellular processes like protein trafficking and ER homeostasis, complete inhibition might cause significant toxicity in normal tissues. Achieving a therapeutic window that affects cancer cells while sparing normal cells represents a substantial challenge.

  • Limited structural information: Though the amino acid sequence is known , detailed structural information about BCAP31's functional domains and interaction interfaces remains incomplete, hampering structure-based drug design efforts.

  • Complex interaction network: BCAP31 participates in numerous protein-protein interactions, making it difficult to selectively disrupt pathological interactions while preserving normal functions.

  • Compensatory mechanisms: Cancer cells may activate alternative pathways to compensate for BCAP31 inhibition, potentially leading to resistance.

  • Biomarker development: Establishing reliable methods to assess BCAP31 status in patient samples and defining clinically relevant expression thresholds will be necessary for patient selection in clinical trials.

Addressing these challenges will require multidisciplinary approaches combining structural biology, medicinal chemistry, and advanced delivery technologies, along with thorough preclinical validation in relevant model systems before clinical translation.

What recombinant BCAP31 protein resources are available for research?

Several recombinant BCAP31 protein resources are available for research applications:

  • Full-length human BCAP31 protein: Commercial sources provide recombinant human BCAP31 spanning the complete 246 amino acid sequence . These proteins are typically expressed in systems such as wheat germ cell-free expression systems, which can maintain proper folding of membrane proteins .

  • Expression systems: Available recombinant BCAP31 proteins are produced using various expression systems, each with specific advantages:

    • Wheat germ: Produces full-length protein suitable for functional studies

    • E. coli: Cost-effective but may have limitations for transmembrane proteins

    • Mammalian cells: Provide proper post-translational modifications

    • Insect cells: Balance between yield and proper folding

  • Tagged variants: Recombinant BCAP31 proteins with various affinity tags (His, GST, MBP) facilitate purification and detection in experimental settings.

  • Domain-specific constructs: Some resources offer truncated versions containing specific functional domains of BCAP31, useful for studying domain-specific interactions.

  • Application compatibility: Available recombinant BCAP31 proteins are typically validated for multiple applications, including:

    • SDS-PAGE analysis

    • Western blotting

    • ELISA

    • Protein-protein interaction studies

When selecting recombinant BCAP31 for research, considerations should include the expression system, purification method, tag position (N- or C-terminal), and validation data for specific applications. For functional studies, it's crucial to verify that the recombinant protein maintains native conformation and activity relevant to the research question.

How can researchers effectively validate BCAP31 antibodies for experimental use?

Effective validation of BCAP31 antibodies is crucial for obtaining reliable experimental results. A comprehensive validation approach should include:

  • Western blot validation:

    • Positive controls: Cell lines with known BCAP31 expression (e.g., KYSE-150 cells)

    • Negative controls: BCAP31-knockout cells or cells treated with validated BCAP31 siRNA

    • Expected molecular weight: Confirm detection at ~28-31 kDa (full-length) or ~20 kDa (cleaved p20 fragment during apoptosis)

    • Loading controls: Include housekeeping proteins (β-actin, GAPDH) for normalization

  • Immunohistochemistry validation:

    • Tissue panels: Test antibody on multiple tissue types with known BCAP31 expression patterns

    • Blocking peptide: Confirm specificity using the immunizing peptide to block antibody binding

    • Optimization: Titrate antibody concentrations and test multiple antigen retrieval methods

    • Cross-validation: Compare staining patterns with multiple antibodies targeting different BCAP31 epitopes

  • Immunofluorescence validation:

    • Co-localization: Confirm ER localization using established ER markers (calnexin, PDI)

    • siRNA knockdown: Verify reduced signal following BCAP31 knockdown

    • Subcellular fractionation: Confirm enrichment in ER membrane fractions

  • Cross-platform validation:

    • mRNA correlation: Compare protein expression (by Western blot/IHC) with mRNA expression (by qRT-PCR)

    • Mass spectrometry: Confirm antibody specificity through immunoprecipitation followed by mass spectrometry

  • Experimental controls for ongoing use:

    • Lot-to-lot validation: Test new antibody lots against previous lots

    • Application-specific optimization: Determine optimal conditions for each experimental method

    • Regular inclusion of positive and negative controls in experiments

By implementing this comprehensive validation approach, researchers can ensure antibody specificity and reliability, reducing the risk of misleading results in BCAP31 studies.

What cell line models are most appropriate for studying BCAP31 functions?

Selecting appropriate cell line models is critical for studying BCAP31 functions effectively. Based on available research, the following cell line models are recommended:

  • Cancer cell lines with high BCAP31 expression:

    • KYSE-150 (esophageal squamous cell carcinoma): Successfully used for BCAP31 knockdown studies and functional assays (migration, invasion, colony formation)

    • Lung adenocarcinoma cell lines: Demonstrated high BCAP31 expression in tumor samples

    • Hepatocellular carcinoma cell lines: Relevant based on BCAP31's prognostic significance in LIHC

  • Cell lines for specific functional studies:

    • For protein trafficking: HeLa or COS-7 cells provide well-characterized secretory pathways

    • For apoptosis studies: HeLa or Jurkat cells offer established models for apoptotic signaling

    • For ER stress responses: HEK293 or CHO cells are frequently used in ER stress research

  • Model systems for mechanistic studies:

    • Matched isogenic lines: Cell lines with BCAP31 knockout/knockdown paired with wild-type counterparts provide controlled systems for studying BCAP31-dependent phenotypes

    • Inducible expression systems: Tet-On/Tet-Off systems allow temporal control of BCAP31 expression for studying acute versus chronic effects

    • CRISPR-engineered lines: Cells with targeted mutations in specific BCAP31 domains help dissect domain-specific functions

  • Physiologically relevant models:

    • Primary cells: When possible, primary cells derived from tissues of interest provide more physiologically relevant contexts

    • 3D culture systems: Organoids or spheroids more accurately recapitulate tissue architecture and cell-cell interactions

    • Co-culture systems: For studying BCAP31's role in tumor-immune interactions, co-cultures with immune cells are valuable

When selecting cell lines, researchers should consider baseline BCAP31 expression levels, the specific cellular processes being studied, genetic background, and growth characteristics. Validating key findings across multiple cell lines helps ensure broader relevance of the discoveries.

How might single-cell analysis enhance our understanding of BCAP31 in heterogeneous tumors?

Single-cell analysis offers transformative potential for understanding BCAP31's roles in heterogeneous tumors through several key approaches:

  • Cellular heterogeneity mapping: Single-cell RNA sequencing (scRNA-seq) can reveal cell type-specific BCAP31 expression patterns within the complex tumor ecosystem. This approach could identify specific cellular populations where BCAP31 is highly expressed or particularly functional, potentially uncovering specialized roles in distinct cellular compartments that bulk analysis would miss.

  • Co-expression network analysis: At the single-cell level, gene co-expression networks involving BCAP31 can be constructed for different cell populations, revealing cell type-specific regulatory relationships and potential functional partners of BCAP31 in various cellular contexts.

  • Trajectory analysis: Single-cell trajectory inference methods could elucidate how BCAP31 expression changes during cancer progression, potentially identifying critical transition states where BCAP31 influences cellular fate decisions or phenotypic transitions.

  • Spatial context integration: Combining single-cell transcriptomics with spatial technologies (e.g., spatial transcriptomics, multiplexed immunofluorescence) could reveal how BCAP31 expression varies across different microenvironmental niches within tumors, particularly in relation to immune infiltrates where BCAP31 shows significant correlations .

  • Treatment response heterogeneity: Single-cell analysis before and after treatment could reveal how cellular subpopulations with varying BCAP31 expression respond differently to therapy, potentially explaining the observed correlations between BCAP31 and drug sensitivity .

  • Regulatory mechanism identification: Single-cell multi-omics approaches combining transcriptomics with epigenomics could uncover cell type-specific regulatory mechanisms controlling BCAP31 expression, potentially explaining its differential expression across cancer types .

These approaches would significantly advance our understanding beyond current bulk analysis methods, potentially revealing new therapeutic opportunities targeting BCAP31 in specific cellular contexts or tumor states.

What is the potential role of BCAP31 in cancer stem cell maintenance?

Although direct evidence linking BCAP31 to cancer stem cell (CSC) maintenance remains limited, several converging lines of evidence suggest potential roles that warrant investigation:

  • Relationship to stemness pathways: BCAP31's associations with various signaling pathways implicated in stemness regulation, including its influence on cell survival and stress responses, suggest potential involvement in maintaining stem-like properties .

  • Impact on therapeutic resistance: The correlation between BCAP31 expression and sensitivity to various therapies aligns with CSCs' known role in therapeutic resistance. BCAP31 might contribute to CSC survival under treatment pressure through its roles in ER stress responses and apoptotic regulation.

  • Influence on cellular plasticity: BCAP31's involvement in protein trafficking and cellular stress responses could impact cellular plasticity and adaptive responses, which are key features of CSCs adapting to microenvironmental changes.

  • Potential impact on self-renewal: The observed effects of BCAP31 knockdown on colony formation suggest influence on long-term proliferative potential, a hallmark of cancer stem cells.

  • Role in tumor initiation: BCAP31's promotion of migration and invasion capabilities parallels the enhanced metastatic potential often attributed to CSCs.

To investigate these potential relationships, research approaches could include:

  • Examining BCAP31 expression in isolated CSC populations using established CSC markers

  • Evaluating the impact of BCAP31 modulation on sphere formation ability and expression of stemness markers

  • Assessing whether BCAP31 influences CSC-associated phenotypes such as quiescence, self-renewal, and differentiation potential

  • Investigating BCAP31's role in CSC-related therapeutic resistance mechanisms

Such studies could reveal whether BCAP31 represents a novel regulator of cancer stemness and potentially a therapeutic target for eliminating resistant CSC populations.

How might BCAP31 contribute to metabolic reprogramming in cancer cells?

BCAP31's potential contributions to metabolic reprogramming in cancer cells represent an unexplored but promising area for investigation, particularly given its localization at the ER-mitochondria interface and its associations with various cancer-related pathways:

Research strategies to explore these connections could include:

  • Metabolic profiling of cells with modulated BCAP31 expression

  • Analysis of mitochondrial function (oxygen consumption, ATP production) following BCAP31 manipulation

  • Investigation of BCAP31's impact on metabolic adaptation to stress conditions

  • Examination of potential interactions between BCAP31 and key metabolic regulators

Understanding BCAP31's role in cancer metabolism could reveal new therapeutic vulnerabilities and strategies for metabolic targeting of cancer cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.