Recombinant Human B1 bradykinin receptor (BDKRB1)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

BDKRB1 is a 353-amino-acid protein encoded by the BDKRB1 gene (Gene ID: 623; UniProt: P46663) localized on human chromosome 14. Unlike its constitutively expressed counterpart BDKRB2, BDKRB1 is induced during tissue injury, inflammation, or metabolic stress .

Key Features:

PropertyDetail
Receptor TypeG-protein coupled (Class A rhodopsin-like)
LigandsDes-Arg<sup>9</sup>-bradykinin, des-Arg<sup>10</sup>-kallidin
Signaling Pathway↑ Cytosolic Ca<sup>2+</sup>, NF-κB activation, COX-2 induction
Tissue DistributionUpregulated in inflamed tissues, placenta, and brown adipose tissue

Recombinant BDKRB1 retains these functional attributes and is typically expressed in mammalian systems (e.g., HEK293 cells) for pharmacological studies .

2.1. Drug Development

Recombinant BDKRB1 enables high-throughput screening of antagonists for inflammatory and neuropathic pain. For example:

  • WIN 64338: A B2 antagonist tested in mice reduced stress-induced hyperthermia (SIH), suggesting cross-receptor modulation .

  • Bradyzide: A B1/B2 antagonist showed mixed anxiolytic effects in murine models, highlighting receptor-specific complexities .

2.2. Disease Mechanisms

  • Diabetes: BDKRB1 knockout mice exhibited reduced neutrophil apoptosis and hypoalgesia in streptozotocin-induced diabetes .

  • Anxiety Disorders: Human genetic studies linked BDKRB1 SNPs (e.g., rs12030568) to anxiety disorders (p < 0.001) .

  • Preterm Labor: BDKRB1 and BDKRB2 are upregulated in term amniotic tissues, implicating kinins in parturition .

2.3. Antibody Production

Recombinant BDKRB1 serves as an immunogen for polyclonal antibodies (e.g., ab77366, bs-8675R), validated in Western blot (WB), ELISA, and immunohistochemistry (IHC) .

Challenges in Recombinant Expression

  • Species Selectivity: Human BDKRB1 exhibits low homology with rodent receptors, necessitating transgenic models for in vivo studies .

  • Promoter Complexity: Regulatory elements outside the core promoter (-1349/+42) may govern induction, complicating recombinant system design .

Clinical and Therapeutic Implications

Recombinant BDKRB1 has elucidated pathways for:

  • Chronic Pain: B1 receptor antagonists (e.g., LF22-0542) show promise in preclinical trials .

  • Cancer: B1 agonists promote DU145 prostate cancer cell proliferation, suggesting oncogenic roles .

  • COVID-19: BDKRB1 is implicated in vascular permeability changes observed in severe infections .

Future Directions

  • Gene-Editing Models: CRISPR-modified cell lines to study receptor trafficking and signaling .

  • Multi-Omics Integration: Linking BDKRB1 SNPs (e.g., rs116438768) to tissue-specific expression in human biobanks .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include your desired format in the order notes, and we will fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for precise delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. Should you require dry ice shipping, please contact us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend a brief centrifugation of the vial prior to opening to concentrate the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
BDKRB1; BRADYB1; B1 bradykinin receptor; B1R; BK-1 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
Uniprot No.

Target Background

Function
This protein serves as a receptor for bradykinin. It could be a contributing factor in chronic pain and inflammation.
Gene References Into Functions
  1. Research indicates that serum B1R levels may hold prognostic value and potentially act as indicators for progression in atherosclerosis. PMID: 28990089
  2. Data reveal that mRNA and protein of bradykinin type 2 receptors, but not bradykinin type 1 receptors, are abundant in cultured c-Kit+ progenitor cells. PMID: 28099911
  3. Promotes adhesion of neutrophils to endothelial cells PMID: 24728914
  4. kB1R heterodimerizes with kB2Rs in co-transfected HEK293 cells and natively expressing endothelial cells, leading to significant internalization and desensitization of the kB1R response in cells pre-treated with kB2R agonist. PMID: 25289859
  5. BKR1 and BKR2 gene expression on peripheral monocytes is upregulated in essential hypertension PMID: 24401952
  6. B1 receptor-mediated vasodilatation in myometrial vessels is absent in pre-eclampsia PMID: 24304135
  7. B1R agonist serves as a functional stimulus for the secretion of KLK1 and KLK6, events relevant for kinin production and cell invasion, respectively PMID: 25503118
  8. Bradykinin B1 receptor signaling relies on receptor endocytosis. PMID: 23934212
  9. APJ and B1R can form heterodimers in transfected HEK293 cells, and activations of APJ and B1R could up-regulate eNOS phosphorylation PMID: 24686079
  10. Studies investigated whether IL-4 and IL-13 can affect the expression of B1 and B2 kinin receptors; data reveal, for the first time, that IL-4 and IL-13 decrease kinin receptors through a STAT6-dependent mechanism PMID: 23351078
  11. A novel B1R splice variant and promoter regulatory elements determine tissue-specific B1R expression. PMID: 24475248
  12. The relevance of kinin B1 and B2 receptors in bladder cancer was investigated. PMID: 23224295
  13. CPM binding to extracellular loop 2 of the B1R results in positive allosteric modulation of B1R signaling, and disruption of this interaction could offer a novel therapeutic approach to reduce pathological B1R signaling. PMID: 24108126
  14. This review highlights airway MAPK/NFkappaB-dependent kinin receptor upregulation that links environmental risk factors to airway hyperreactivity and airway inflammation. PMID: 23428345
  15. Kinin B1 receptor homo-oligomerization is essential for receptor trafficking to the cell surface PMID: 23201435
  16. Bradykinin B1 receptor is induced in inflammatory diseases and contributes to hyperthermia through a vagal sensory mechanism. PMID: 22971439
  17. A peptidase-resistant BR agonist exhibited no significant direct or indirect acute effect (4h) on BR expression. PMID: 21986309
  18. The transcriptional activity of the B1 receptor for kinins increased in patients with grade 1 and grade 2 endometrial cancer compared to the control group, whereas it decreased in patients with grade 3 endometrial cancer. PMID: 22706224
  19. bradykinin B1 is inhibited by chromomenones PMID: 22088753
  20. The up-regulation of HER2 and B(1)R in precursor lesions of gallbladder carcinoma suggests cross-talk between these two receptors that may be important in modulating cell proliferation in gallbladder carcinogenesis. PMID: 22468084
  21. Taken together, this study demonstrates that Pseudomonas aeruginosa is capable of up-regulating human B1R expression through the NF-kappaB signaling pathway. PMID: 22092568
  22. Comparing phospholipase C beta activity and Ca(2+)-regulated signals, a temperature-dependent increase was observed only for bradykinin B(1) but not for bradykinin(2)receptor activation. PMID: 21871009
  23. Remote ischemic preconditioning reduces expression of kinin receptors on circulating human neutrophils. PMID: 20189583
  24. CPM and B1Rs on cell membranes form a critical complex that potentiates B1R signaling. PMID: 21454694
  25. Data suggest that B1R inhibition can reduce BBB damage and cell invasion during autoimmune CNS disease, potentially offering a novel anti-inflammatory strategy for treating MS. PMID: 21216565
  26. Release of metalloproteases-2 and -9 is blocked after silencing the kinin B1 receptor with siRNA. PMID: 21147512
  27. Severe inflammation characterizes rapidly progressive glomerulonephritides, and expression of the kinin B1 receptor (B1R) correlates with inflammation. PMID: 20448019
  28. The up-regulation of B1 receptors may contribute to acute inflammatory pain through TRPV1 activation. PMID: 20152050
  29. Human chondrosarcoma tissues exhibited significantly higher expression of the B1 and B2 receptors compared to normal cartilage PMID: 19885862
  30. Laminar shear stress is a major determinant of functional B1R expression in endothelium. PMID: 19661485
  31. B(1)R-epidermal growth factor receptor crosstalk may be a key interaction that sustains tumor growth PMID: 19184415
  32. Both B1 receptor and gC1q receptor are involved in the vascular leakage induced by hereditary and acquired angioedema plasma. PMID: 19796797
  33. B1 and B2 receptor expression was enhanced in tumor cells and tissue adjacent to gastric cancer compared with gastric ulcers. PMID: 11710536
  34. Novel mode of action of angiotensin I converting enzyme inhibitors: direct activation of bradykinin B1 receptor PMID: 11880373
  35. Bradykinin B1 receptors are upregulated by inflammatory stimuli in bronchial epithelial cells. PMID: 12063092
  36. The C-terminal domain plays a significant role in the efficacy of B1R and B2R G(q/11) coupling by contributing both positive and negative regulatory epitopes. PMID: 12130679
  37. Allergic rhinitis subjects displayed significantly higher expression of B1 receptor mRNA compared to normal subjects. PMID: 12165532
  38. B1R exists in caveolae-related lipid rafts (CLRs) in HEK293 cells apparently by default, as a result of their random distribution in the plasma membrane and not by being specifically targeted to the CLR fraction. PMID: 12450400
  39. B1 and B2 bradykinin receptors form a complex with enhanced signaling capacity PMID: 15033977
  40. Bradykinin B(1) receptor homooligomerization is required for expression of receptors on the cell surface and subsequent constitutive receptor signaling. PMID: 15492119
  41. Kinin B(1) receptors participate in painful and inflammatory disorders--REVIEW PMID: 15520046
  42. Slow internalization of B(1)KB(2) was also accompanied by a lack of agonist-induced phosphorylation, which in contrast was observed for B(1)YB(2) and B(1)CB(2), suggesting that putative helix 8 is either directly or indirectly involved PMID: 15634338
  43. The two bradykinin receptors may play a role in blood pressure regulation PMID: 15643125
  44. The B1 kinin receptor does not have a major vasomotor or fibrinolytic role in patients with heart failure PMID: 15681300
  45. Use of the highly sensitive DNase I in vivo footprinting approach to delineate more precisely the functional domains of the BDKRB1 gene promoter in human smooth muscle cells is reported. PMID: 15705059
  46. Bradykinin receptors in inflammatory bowel disease may reflect intestinal inflammation PMID: 15805101
  47. A novel class of 2,3-diaminopyridine bradykinin B1 receptor antagonists is disclosed using structure-activity relationship studies. PMID: 15837330
  48. BK-1Rs are induced in the endothelium of intramyocardial coronary vessels in failing human hearts, suggesting their potential involvement in the pathogenesis of heart failure. PMID: 15840906
  49. Kinin B1 receptor expression on multiple sclerosis mononuclear cells PMID: 15883268
  50. Increased levels of bradykinin receptor B1 in adenoma suggest that kinins may play a role in abnormal cellular transformation. PMID: 16644486

Show More

Hide All

Database Links

HGNC: 1029

OMIM: 600337

KEGG: hsa:623

STRING: 9606.ENSP00000216629

UniGene: Hs.525572

Protein Families
G-protein coupled receptor 1 family, Bradykinin receptor subfamily, BDKRB1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the B1 bradykinin receptor and what distinguishes it from other bradykinin receptors?

The bradykinin B1 receptor (BDKRB1) is an inducible G-protein-coupled receptor encoded by the BDKRB1 gene in humans. Unlike the constitutively expressed B2 receptor, the B1 receptor is specifically induced or upregulated at sites of inflammation or injury . Structurally, the B1 receptor is a 353-amino acid protein with G-protein-coupled receptor characteristics, sharing approximately 36% sequence identity with the B2 bradykinin receptor . The principal ligand for the B1 receptor is bradykinin, a 9-amino acid peptide generated during pathophysiologic conditions such as inflammation, trauma, burns, shock, and allergic reactions .

What are the primary agonists and antagonists for the BDKRB1 receptor?

The B1 receptor demonstrates distinct pharmacological properties compared to the B2 receptor. The cloned B1 bradykinin receptor exhibits high-affinity binding for des-Arg10-kallidin (a selective B1 receptor agonist) and low affinity for bradykinin . Classical agonists include bradykinin1-8 (bradykinin with the first 8 amino acids) . Regarding antagonists, [des-Arg10,Leu9]kallidin effectively displaces des-Arg10-kallidin from the cloned receptor, while B2 receptor antagonists like Hoe-140 do not demonstrate significant binding . Two major classes of small-molecule B1 antagonists have been developed: arylsulfonamide-based and biphenyl-based antagonists .

How is BDKRB1 expression regulated at the cellular level?

The B1 receptor undergoes de novo synthesis following tissue injury, making it distinct from many constitutively expressed receptors . The up-regulation of B1 receptor expression involves nuclear factor-kappaB (NF-κB) activation, as evidenced by the inhibitory effect of pyrrolidine dithiocarbamate (an inhibitor of NF-κB activation) on B1 receptor sensitization . Tumor necrosis factor-alpha (TNF-α) potentiates B1 receptor responses without modifying the maximal response to des-Arg9-BK . Experimental evidence using transcription and translation inhibitors (actinomycin D and cycloheximide, respectively) confirms that de novo synthesis of a transmembrane glycoprotein is essential for B1 receptor up-regulation . Notably, the time required for synthesis, trafficking, and functional membrane expression of this receptor is less than 1 hour, indicating an efficient induction pathway .

What are the optimal cell lines and expression systems for studying recombinant BDKRB1?

For recombinant expression of human BDKRB1, several expression systems have proven effective. Chinese hamster ovary (CHO-K1) cells represent a well-established host cell line for expressing recombinant human B1 receptors . Additionally, human embryonic lung fibroblasts have been successfully used for expression cloning of the human B1 bradykinin receptor . When preparing membrane preparations for binding assays, cells expressing recombinant or endogenous receptors can be selected for optimal performance .

The expression of recombinant BDKRB1 typically couples to Gq/G11 signaling pathways, leading to increased cytosolic calcium ion concentration upon receptor activation . These membrane preparations are suitable for various high-throughput screening applications, including radioligand binding assays using either proximity methods (such as FlashPlate) or classical filtration methods .

How can researchers effectively measure BDKRB1 activation and signaling?

When studying BDKRB1 signaling, several experimental approaches have proven effective:

  • Calcium mobilization assays: The photoprotein aequorin can be utilized as an indicator of B1 receptor agonist-mediated Ca²⁺ mobilization, as demonstrated in expression studies using Xenopus laevis oocytes .

  • Radioligand binding assays: 3H-labeled [des-Arg10]kallidin binding provides a reliable method for assessing B1 receptor expression and ligand affinity. Competition binding assays with known reference agonists and antagonists allow determination of receptor affinity (Ki) .

  • Functional membrane expression: Concentration-response curves to des-Arg9-BK (a selective B1 receptor agonist) can be performed after appropriate incubation periods to assess receptor functionality .

  • Molecular signaling pathway analysis: Downstream signaling events can be monitored, such as the MEK1-ERK1/2-NF-κB pathway activation that follows BDKRB1-mediated calcium influx in certain cell types .

What methodological approaches are recommended for studying BDKRB1 in disease models?

When investigating BDKRB1 in disease models, researchers have successfully implemented the following methodological approaches:

  • RNA interference (RNAi): Knocking down BDKRB1 expression using siRNA has proven effective for evaluating the receptor's role in pathological processes. In glioblastoma studies, application of BDKRB1 siRNA to human U87 MG cells led to substantial reduction in levels of associated proteins like AQP4 .

  • Wound-healing and invasion assays: These techniques can assess the functional consequences of BDKRB1 modulation. In glioblastoma cells, exposure to bradykinin (100 nM for 24h) triggered 2.6-fold wound-healing activity, while knocking down BDKRB1 caused a 60% reduction in bradykinin-induced wound-healing .

  • Pharmacological interventions: Various inhibitors targeting components of the signaling pathway (e.g., pyrrolidine dithiocarbamate for NF-κB inhibition) help dissect the mechanisms involved in BDKRB1-mediated effects .

How does BDKRB1 contribute to inflammatory and pain pathways?

The B1 bradykinin receptor plays a significant role in inflammatory and pain pathways. Unlike the constitutively expressed B2 receptor, the B1 receptor is specifically induced or upregulated at inflammation or injury sites, making it particularly relevant to chronic inflammatory conditions . Receptor binding leads to increased cytosolic calcium concentration, ultimately resulting in chronic and acute inflammatory responses .

A substantial body of preclinical data supports the development of B1 antagonists as novel therapeutics for treating pain and inflammation . The inducible nature of the B1 receptor makes it a particularly attractive target, as it is primarily expressed at sites of tissue injury rather than in healthy tissues. This targeted expression profile potentially offers advantages in terms of specificity and reduced side effects compared to constitutively expressed receptors .

What is the relationship between BDKRB1 and aquaporin 4 (AQP4) in glioblastoma progression?

Research has revealed a significant relationship between BDKRB1 and aquaporin 4 (AQP4) in glioblastoma progression. The bradykinin-BDKRB1 axis regulates AQP4 gene expression in glioblastoma cells through a specific signaling cascade . Exposure to bradykinin induces AQP4 expression through BDKRB1-mediated calcium influx and subsequent activation of a MEK1-ERK1/2-NF-κB pathway .

Experimental data demonstrate that knocking down BDKRB1 using RNA interference concurrently decreases AQP4 mRNA expression and inhibits cell migration and invasion. Specifically, application of BDKRB1 siRNA to human U87 MG cells led to a 72% reduction in BDKRB1 expression and a corresponding 76% inhibition in bradykinin-induced AQP4 mRNA expression . Functionally, this resulted in a 60% reduction in bradykinin-induced wound-healing activity and significantly decreased cell invasion .

These findings suggest that the bradykinin-BDKRB1 axis and AQP4 could serve as precise targets for treating glioblastoma multiforme (GBM) patients, offering a potential therapeutic pathway to address this aggressive form of cancer .

What are the current challenges in developing selective BDKRB1 antagonists for therapeutic use?

The development of selective BDKRB1 antagonists presents several research challenges. While two major classes of small-molecule B1 antagonists (arylsulfonamide-based and biphenyl-based) have been disclosed, optimizing selectivity, potency, and pharmacokinetic properties remains challenging .

What are the optimal conditions for preparing BDKRB1 membrane fractions for binding studies?

When preparing BDKRB1 membrane fractions for binding studies, several technical considerations are important:

  • Expression system selection: CHO-K1 cells have been successfully used as host cells for expressing recombinant human BDKRB1 . These cells provide a reliable platform for receptor expression and membrane preparation.

  • Membrane preparation: Bradykinin B1 receptor membranes are typically prepared at concentrations of approximately 12.5 μg/μL protein, with standard units containing about 50 μg protein . This concentration is optimized for binding assays.

  • Quality control testing: Every batch of receptor membrane preparations should undergo stringent quality control testing, including:

    • Saturation radioligand binding assays to determine receptor concentration (Bmax) and affinity (Kd)

    • Competition binding assays to determine affinity (Ki) against known reference agonists and antagonists

    • GTPγS data for Gi-coupled receptors

  • Storage and handling: Membrane preparations are typically stored as frozen crude membrane preparations and should be handled according to specific protocols to maintain receptor integrity .

How can researchers differentiate between B1 and B2 receptor-mediated effects in experimental systems?

Differentiating between B1 and B2 receptor-mediated effects is crucial for understanding the specific contribution of each receptor subtype. Several approaches can be employed:

  • Selective agonists and antagonists: Using receptor-selective compounds is the most direct approach. Des-Arg10-kallidin and des-Arg9-BK serve as selective B1 receptor agonists, while [des-Arg10,Leu9]kallidin functions as a B1 receptor antagonist . Conversely, B2 receptor antagonists like Hoe-140 (D-Arg0-[Hyp3,Thi5,D-Tic7,Oic8]bradykinin) do not bind to B1 receptors .

  • Temporal expression patterns: The B1 receptor is inducible and upregulated following tissue injury or inflammation, whereas the B2 receptor is constitutively expressed . Experiments can exploit this difference by examining responses before and after inflammatory stimulation.

  • Genetic approaches: RNA interference targeting BDKRB1 specifically can help isolate B1-mediated effects from those mediated by B2 receptors .

  • Pharmacological induction and inhibition: The up-regulation of B1 receptors can be potentiated by tumor necrosis factor-alpha and inhibited by pyrrolidine dithiocarbamate (through NF-κB inhibition) . These tools provide additional mechanisms to manipulate B1 receptor expression selectively.

What are the critical variables that affect BDKRB1 expression and functionality in experimental systems?

Several critical variables significantly impact BDKRB1 expression and functionality in experimental systems:

  • Inflammatory mediators: Tumor necrosis factor-alpha (TNF-α) potentiates B1 receptor responses, suggesting that inflammatory cytokines play a crucial role in regulating receptor expression and function .

  • Nuclear factor-kappaB (NF-κB) activation: Pyrrolidine dithiocarbamate, an inhibitor of NF-κB activation, produces a concentration-dependent decrease in B1 receptor sensitization, indicating the importance of this transcription factor in receptor up-regulation .

  • Transcription and translation: The de novo synthesis of B1 receptors is highly sensitive to transcription inhibitors (actinomycin D) and protein synthesis inhibitors (cycloheximide), highlighting the critical role of ongoing gene expression in maintaining receptor levels .

  • Post-translational modifications: N-linked glycosylation appears to be essential for B1 receptor functionality, as the glycosylation inhibitor tunicamycin almost completely abolishes des-Arg9-BK-mediated responses .

  • Incubation time and conditions: The time required for synthesis, trafficking, and functional membrane expression of the B1 receptor is less than 1 hour, indicating that experimental protocols need to account for this rapid induction and expression kinetics .

How does BDKRB1 contribute to vascular responses, and what experimental models best capture these effects?

The B1 bradykinin receptor plays a significant role in vascular responses, particularly under pathophysiological conditions. De novo synthesis of the B1 receptor is involved in the induction of vascular responses in the human umbilical vein (HUV), making this an important model system for studying B1-mediated vascular effects .

In HUV experimental models, concentration-response curves to des-Arg9-BK (a selective B1 receptor agonist) can be performed after appropriate incubation periods (typically 5 hours) to assess receptor functionality . This model has revealed several key aspects of B1 receptor pharmacology:

  • Inflammatory potentiation: Tumor necrosis factor-alpha potentiates B1 receptor responses without modifying the maximal response to des-Arg9-BK, suggesting a role in receptor sensitization rather than increased expression .

  • Signaling pathway: B1 receptor up-regulation in HUV involves nuclear factor-kappaB activation, as evidenced by the inhibitory effect of pyrrolidine dithiocarbamate .

  • Protein synthesis requirements: The de novo synthesis of a transmembrane glycoprotein is essential for B1 up-regulation, with the time necessary for synthesis, trafficking, and functional membrane expression being less than 1 hour .

The HUV model therefore represents an excellent system for studying the induction and function of B1 receptors in vascular tissue, particularly in the context of inflammatory conditions.

What role does BDKRB1 play in glioblastoma progression, and how can this pathway be targeted therapeutically?

BDKRB1 plays a significant role in glioblastoma progression through several mechanisms:

  • Regulation of AQP4 expression: The bradykinin-BDKRB1 axis regulates aquaporin 4 (AQP4) gene expression in glioblastoma cells. Exposure to bradykinin induces AQP4 expression by 3.6-fold in human U87 MG glioblastoma cells .

  • Calcium signaling: This regulation occurs through BDKRB1-mediated calcium influx and subsequent activation of a MEK1-ERK1/2-NF-κB pathway .

  • Enhanced cell migration and invasion: Exposure of human U87 MG glioblastoma cells to bradykinin (100 nM for 24h) triggers 2.6-fold wound-healing activity and 11-fold increased cell invasion .

  • Validation through knockdown studies: Knocking down BDKRB1 using RNA interference causes a significant 76% inhibition in bradykinin-induced AQP4 mRNA expression, a 60% reduction in wound-healing activity, and decreased cell invasion .

These findings suggest that the bradykinin-BDKRB1 axis could be a precise target for treating glioblastoma multiforme (GBM) patients. Therapeutic approaches might include:

  • Selective B1 receptor antagonists: Compounds that specifically target the B1 receptor could potentially inhibit the bradykinin-induced effects on glioblastoma progression .

  • Interference with downstream signaling: Targeting components of the MEK1-ERK1/2-NF-κB pathway activated by BDKRB1 could provide alternative approaches to inhibit the effects of bradykinin on glioblastoma cells .

  • Combined approaches: Given the complex nature of glioblastoma, combining BDKRB1-targeted therapies with other treatment modalities might offer more comprehensive therapeutic benefits.

What is the current evidence for BDKRB1 as a therapeutic target in pain and inflammatory conditions?

A substantial body of preclinical data supports the development of B1 receptor antagonists as novel therapeutics for treating pain and inflammation . The B1 receptor represents an attractive therapeutic target due to several key characteristics:

  • Inducible expression: Unlike the constitutively expressed B2 receptor, the B1 receptor is specifically induced or upregulated at sites of inflammation or injury, potentially allowing for more targeted therapeutic intervention .

  • Chronic inflammation role: B1 receptor binding leads to increased cytosolic calcium concentration, ultimately resulting in chronic and acute inflammatory responses .

  • Available antagonists: Two major classes of small-molecule B1 antagonists have been disclosed: arylsulfonamide-based and biphenyl-based antagonists . These compounds provide a foundation for further therapeutic development.

  • Established tools for evaluation: The necessary in vitro and in vivo drug discovery tools are currently available to evaluate novel B1 antagonists, facilitating the development and optimization of potential therapeutic compounds .

The selective induction of B1 receptors at sites of tissue injury makes them particularly attractive targets for chronic inflammatory conditions and persistent pain states. By targeting a receptor that is primarily expressed in pathological rather than normal physiological conditions, B1 antagonists might offer advantages in terms of reduced side effects compared to less selective anti-inflammatory approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.