Recombinant Human Bcl-2-interacting killer (BIK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BIK; NBK; Bcl-2-interacting killer; Apoptosis inducer NBK; BIP1; BP4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
BIK
Target Protein Sequence
MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALR LACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMR FWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK
Uniprot No.

Target Background

Function
Recombinant Human Bcl-2-interacting killer (BIK) accelerates programmed cell death. Its death-promoting activity is suppressed by association with apoptosis repressors such as Bcl-X(L), BHRF1, Bcl-2, or its adenovirus homolog E1B 19k protein. It does not interact with BAX.
Gene References Into Functions
  1. TMEM74, an autophagy modulator, interacts with and inhibits the apoptosis inducer BIK. PMID: 28412412
  2. The ERalpha-H19-BIK signaling axis contributes significantly to breast cancer cell chemoresistance. PMID: 27845892
  3. BIK plays a complex role in tumor promotion in Bik-high breast tumors. PMID: 27120789
  4. BIK is a key contributor to DNA damage-induced mitochondrial apoptosis in HCT-116 wt cells, acting upstream of ROS production, BAX and BAK activation, cytochrome c release, and caspase activation. PMID: 28796811
  5. BIK-mediated caspase activation is linked to the cleavage of viral proteins. PMID: 26437021
  6. Suppression of BIK in ER-positive MCF-7 cells prevents the cytotoxic effects of TAM and promotes a more aggressive phenotype through alterations in various molecular pathways. PMID: 25861752
  7. HCV RNA replication and release are significantly suppressed in BIK-depleted cells, while NS5B overexpression induces BIK expression. PMID: 25463603
  8. BikDDA, a novel Bik mutant, exhibits a prolonged half-life and enhanced pro-apoptotic activity in triple-negative breast cancer cells compared to BikDD. PMID: 24637719
  9. SQSTM1/p62 targeting shifts cytoprotective autophagy to an inefficient form due to cargo loading failure, leading to NBK/Bik accumulation and apoptosis initiation. PMID: 25002530
  10. Human herpesvirus 4 EBNA2 represses BIK in B-cell lymphoma-derived cell lines, inhibiting the proapoptotic effects of transforming growth factor beta1. PMID: 24554662
  11. BIK expression in tumor cells is cell-cycle dependent and increases during G1 cell-cycle arrest induced by MAP kinase signaling inhibition. PMID: 24527759
  12. BIK/NBK gene expression holds significant clinical implications as a potential predictive, prognostic, or therapeutic marker in breast cancer. PMID: 22855140
  13. Src tyrosine kinase inhibits apoptosis by Erk1/2-dependent degradation of Bik. PMID: 22388352
  14. DeltaNp73, a p73 isoform, indirectly regulates BIK in FA-C lymphoblasts by activating BIK through a proximal promoter element. PMID: 22873408
  15. Methylation-induced silencing of BIK may occur in multiple myeloma (MM), potentially serving as a predictor of relapse/refractory MM. PMID: 22288719
  16. Significant associations (P < 8.2 x 10-5) were found for single-nucleotide polymorphisms (SNPs) in TP53, LIG1, and BIK. PMID: 22139380
  17. Bik plays a role in apoptosis induction and oxidative stress sensitivity in myeloma cells. PMID: 21063407
  18. The proapoptotic gene bik exhibits systemic tumor suppression. PMID: 11782349
  19. BIK initiates cytochrome c release from mitochondria via an ER-localized mechanism. PMID: 11884414
  20. NBK mediates apoptosis through a BAX-dependent mitochondrial pathway. PMID: 12853473
  21. Sequence alterations in the BIK gene have been identified in peripheral B-cell lymphomas, potentially influencing disease pathogenesis. PMID: 12874789
  22. Bik is induced in MCF-7 cells under estrogen signaling absence and plays a key role in antiestrogen-induced breast cancer cell apoptosis. PMID: 14983013
  23. Bik is degraded in Chlamydia trachomatis-infected cells. PMID: 15731089
  24. Bik and Bim contribute to bortezomib sensitization of cells to TRAIL-mediated killing. PMID: 15767553
  25. BIK activates DRP1 recruitment to the ER, resulting in mitochondrial fragmentation with minimal cytochrome c release. PMID: 15791210
  26. Endogenous BIK regulates a BAX, BAK-dependent ER pathway contributing to mitochondrial apoptosis. PMID: 15809295
  27. Bik/NBK accumulation, resulting from protein stabilization, is linked to bortezomib cytotoxicity and apoptosis induction. PMID: 15824729
  28. Bik does not appear to significantly influence the development and progression of sporadic breast neoplasms in Mexican females. PMID: 16060964
  29. E2Fs transactivate bik through a p53-independent mechanism. PMID: 17027756
  30. BIK expression in human breast cancer cells is regulated at the mRNA level by a p53-mediated nontranscriptional mechanism and by proteasomal degradation. PMID: 17047080
  31. BIK induces caspase-9 activation and mitochondrial membrane depolarization, effects reduced by caspase-12 silencing. PMID: 17574210
  32. KU70, MGST1, and BIK mRNA expression levels show age-related changes in hematopoietic stem cells. PMID: 17714764
  33. Bik-induced apoptosis in Hep3B cells is primarily linked to depletion of ER Ca2+ stores. PMID: 18299962
  34. BIK may not play a major role in schizophrenia susceptibility in the Japanese population. PMID: 19632297
  35. BIK is primarily ER-localized, inducing apoptosis through the mitochondrial pathway. It's involved in mature B cell selection and functions as a pro-apoptotic tumor suppressor in various human tissues. PMID: 19641504
  36. Gene-disease association, gene-environment interaction, and pharmacogenomic/toxicogenomic studies. PMID: 18519826
Database Links

HGNC: 1051

OMIM: 603392

KEGG: hsa:638

STRING: 9606.ENSP00000216115

UniGene: Hs.475055

Subcellular Location
Endomembrane system; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein. Note=Around the nuclear envelope, and in cytoplasmic membranes.

Q&A

What is the molecular mechanism of BIK in the apoptotic pathway?

Recombinant Human Bcl-2-interacting killer (BIK) functions as a pro-apoptotic regulator within the intrinsic pathway of programmed cell death. As a BH3-only protein member of the Bcl-2 family, BIK initiates apoptosis by interacting with anti-apoptotic proteins (like Bcl-2 and Bcl-XL), neutralizing their protective effects. This interaction disrupts the balance between pro-apoptotic and anti-apoptotic factors, ultimately leading to mitochondrial outer membrane permeabilization (MOMP) .

The molecular mechanism involves BIK binding to the hydrophobic groove of anti-apoptotic proteins through its BH3 domain, which prevents these proteins from sequestering and inhibiting the pro-apoptotic executioner proteins (Bax, Bak, or Bok). Once liberated, these executioner proteins can oligomerize within the mitochondrial outer membrane, forming pore complexes that allow the release of pro-apoptotic factors into the cytosol, activating caspases and triggering proteolytic degradation of cellular components .

How does the C-terminal sequence of BIK contribute to its function?

The C-terminal sequence (CTS) of BIK plays a crucial multifunctional role in its pro-apoptotic activity. Like other Bcl-2 family proteins, BIK's CTS serves as more than just a membrane-targeting domain. Recent research has revealed that these conserved C-terminal sequences mediate additional protein-protein binding functions that contribute significantly to regulating MOMP .

Specifically, the CTS of BIK contributes to:

  • Intracellular membrane localization, directing the protein to its site of action

  • Homotypic interactions with other BIK molecules

  • Heterotypic interactions with anti-apoptotic proteins that prevent MOMP

  • Heterotypic interactions with pro-apoptotic executioner proteins that promote MOMP

Understanding these CTS-mediated interactions is essential for developing a complete model of how BIK triggers the apoptotic cascade.

What distinguishes BIK from other BH3-only proteins in the Bcl-2 family?

BIK possesses several distinctive characteristics that differentiate it from other BH3-only proteins:

  • Subcellular localization: Unlike many BH3-only proteins that primarily target the mitochondria, BIK predominantly localizes to the endoplasmic reticulum through its C-terminal sequence.

  • Interaction profile: BIK demonstrates selective binding preferences for certain anti-apoptotic proteins, generally showing stronger affinity for Bcl-2 and Bcl-XL compared to Mcl-1, though these interactions can be context-dependent .

  • Regulatory mechanisms: BIK activity is regulated through distinct post-translational modifications and protein-protein interactions that provide cell-type specific control over its pro-apoptotic function.

  • Apoptotic pathway: While all BH3-only proteins ultimately contribute to MOMP, BIK can initiate apoptotic signaling from the ER, potentially triggering calcium release that subsequently affects mitochondrial integrity.

These distinguishing features make BIK a unique component of the cellular apoptotic machinery with specific regulatory functions.

What considerations are essential when designing experiments with recombinant BIK?

Designing robust experiments with recombinant BIK requires careful planning to maximize data validity and reliability. Key considerations include:

  • Expression system selection: Choose appropriate expression systems based on experiment objectives. Bacterial systems may provide higher yields but lack post-translational modifications, while mammalian systems better preserve native protein conformation but may encounter toxicity issues due to BIK's pro-apoptotic function.

  • Construct design: Consider including epitope tags for detection and purification, but position them to minimize interference with BIK's functional domains. For cellular experiments, fluorescent protein fusions should be tested to ensure functionality is maintained.

  • Randomized block design: Implement blocking to control for nuisance factors (cell passage number, reagent batches) that might affect experimental outcomes. This statistical approach reduces the impact of variables that are not the primary focus of investigation .

  • Appropriate controls: Include both positive controls (known apoptosis inducers) and negative controls (inactive BIK mutants, empty vectors) to establish a framework for interpreting results.

  • Dose-response and time-course elements: BIK's effects are concentration-dependent and develop over time, making these dimensions critical for comprehensive analysis.

A well-designed experimental plan maximizes the potential to collect data that is both trustworthy and able to identify causal relationships between BIK activity and observed cellular responses .

How can I validate the functionality of recombinant BIK protein?

Validating recombinant BIK functionality requires a multi-faceted approach addressing both binding activity and biological effects:

Binding Activity Validation:

  • Protein-protein interaction assays: Förster resonance energy transfer (FRET) provides high spatial resolution for measuring BIK interactions with anti-apoptotic partners. Fluorescence lifetime imaging microscopy (FLIM) is particularly valuable as it is independent of fluorescence intensity variations that complicate other FRET methods .

  • Co-immunoprecipitation: Confirm BIK's ability to bind known interaction partners under native conditions.

  • Surface Plasmon Resonance (SPR): Determine binding kinetics and affinity constants for BIK interactions with purified anti-apoptotic proteins.

Biological Activity Validation:

  • Apoptosis induction: Measure cell death parameters following BIK expression/introduction (phosphatidylserine externalization, DNA fragmentation, membrane integrity).

  • Mitochondrial effects: Assess mitochondrial membrane potential changes and cytochrome c release.

  • Caspase activation: Confirm activation of the caspase cascade using fluorogenic substrates or Western blotting for cleaved caspases.

  • Rescue experiments: Demonstrate that co-expression of anti-apoptotic proteins inhibits BIK-induced effects, confirming mechanism specificity.

Each validation approach should include appropriate controls, and results should be interpreted collectively to establish a comprehensive profile of recombinant BIK functionality.

What experimental controls are essential when studying BIK-induced apoptosis?

Robust experimental controls are crucial for accurate interpretation of BIK-induced apoptosis studies:

Positive Controls:

  • Well-characterized apoptosis inducers (staurosporine, TRAIL)

  • Other pro-apoptotic BH3-only proteins (Bim, Bid)

Negative Controls:

  • Empty vector transfections

  • BIK mutants with disrupted BH3 domain (abolishes binding to anti-apoptotic proteins)

  • BIK mutants with altered C-terminal sequence (affects membrane targeting)

Mechanistic Controls:

  • Caspase inhibitors (z-VAD-fmk) to determine caspase dependency

  • Anti-apoptotic protein overexpression (Bcl-2, Bcl-XL) to confirm specific inhibition

  • Bax/Bak knockout or knockdown cells to verify the requirement for these executioner proteins

Technical Controls:

  • Consistent protein/DNA concentrations across experimental conditions

  • Vehicle controls for all treatments

  • Expression level verification (Western blotting, qPCR)

How can I quantify BIK interactions with anti-apoptotic proteins?

Quantifying BIK interactions with anti-apoptotic proteins requires techniques that provide both specificity and quantitative accuracy:

In Vitro Methods:

  • Surface Plasmon Resonance (SPR): Provides real-time kinetics and affinity constants (Kd values) for purified proteins.

  • Isothermal Titration Calorimetry (ITC): Directly measures binding thermodynamics without labeling requirements.

  • Fluorescence Polarization: Uses labeled BH3 peptides to measure binding affinities through changes in polarization upon protein interaction.

Cellular Methods:

  • FLIM-FRET Analysis: Measures Förster resonance energy transfer using fluorescence lifetime imaging microscopy, providing spatial resolution of interactions within cells. This technique is ideal because the time a population of donor fluorophores remains in the excited state is independent of intensity changes that complicate other FRET methods .

  • Quantitative Co-Immunoprecipitation: Allows calculation of apparent binding constants by varying protein expression levels and measuring co-precipitated fractions.

  • Split-Luciferase Complementation Assays: Provides a quantifiable readout of protein-protein interactions through luminescence signal.

When interpreting interaction data, it's important to recognize that results from different methods may vary due to differences in experimental conditions. FLIM-FRET can be particularly valuable as it enables determination of apparent binding constants (Kd) that incorporate all competing interactions in the cellular environment .

What approaches can detect changes in BIK binding to different anti-apoptotic proteins?

Detecting differential binding of BIK to various anti-apoptotic proteins requires methods that can resolve binding selectivity and competition:

Competitive Binding Assays:

  • Displacement assays: Measure the ability of unlabeled competitors to displace BIK from pre-formed complexes with different anti-apoptotic proteins.

  • FRET-based competition: Monitor changes in FRET signal when introducing competing proteins.

Binding Profile Analysis:

  • Protein microarrays: Screen BIK binding against multiple anti-apoptotic proteins simultaneously.

  • BH3 profiling: Measure mitochondrial membrane permeabilization in response to BIK in cells with different anti-apoptotic protein expression profiles.

Mutational Analysis:

  • Alanine scanning: Systematically replace residues in BIK's BH3 domain to identify those critical for binding specific anti-apoptotic proteins.

  • C-terminal sequence modifications: Alter BIK's CTS to evaluate its contribution to binding specificity.

When analyzing binding data for multiple interactions, a quantitative approach comparing the efficacy of inhibitors (or binding partners) provides a more comprehensive understanding of selectivity and efficacy . Changes in apparent binding constants (Kd) offer a quantitative comparison that incorporates all competing interactions within the cellular context.

How do membrane environments affect BIK function and interactions?

Membrane environments play critical roles in modulating BIK function and interactions:

Membrane Targeting Effects:

  • The C-terminal sequence of BIK mediates its localization to intracellular membranes, influencing its spatial distribution and access to interaction partners .

  • Different membrane compositions can affect the orientation and conformation of membrane-inserted BIK.

Functional Consequences:

  • Membrane insertion can induce conformational changes that alter BIK's BH3 domain accessibility.

  • Membrane microdomains may concentrate or segregate BIK and its binding partners, affecting local concentrations and interaction kinetics.

  • Membrane curvature may influence the oligomerization of BIK or its downstream effectors.

Experimental Approaches:

  • Liposome-based assays: Compare BIK binding and function with liposomes of varying lipid compositions mimicking different cellular membranes.

  • Subcellular fractionation: Isolate different membrane compartments to analyze BIK distribution and binding partner co-localization.

  • FRET microscopy: Visualize interactions in different membrane compartments within intact cells.

Understanding the membrane context is essential since the interactions between Bcl-2 family proteins that regulate MOMP are critically influenced by the membrane environment where they occur .

How should I analyze contradictory results in BIK interaction studies?

Contradictory results in BIK interaction studies require systematic analysis using a structured approach:

Methodological Assessment:

  • Compare experimental techniques used (in vitro binding vs. cellular assays)

  • Evaluate protein constructs (full-length vs. truncated, presence/absence of membrane-binding domains)

  • Assess experimental conditions (buffer composition, temperature, presence of membranes)

Biological Context Evaluation:

  • Consider cell-type specific factors (expression levels of other Bcl-2 family members)

  • Evaluate post-translational modifications that may alter BIK interactions

  • Analyze subcellular localization differences that might explain varied results

Resolution Framework:

  • Replication with multiple methods: Confirm findings using complementary techniques to overcome methodological limitations.

  • Systematic variable testing: Identify specific conditions that explain divergent results.

  • Context-dependent modeling: Develop a model that incorporates conditions under which different interaction patterns occur.

For assessing the reliability of contradictory evidence, apply the GRADE approach (Grading of Recommendations Assessment, Development and Evaluation), which evaluates certainty based on risk of bias, inconsistency, indirectness, imprecision, and publication bias . This structured assessment helps determine which results are most reliable and under what conditions they apply.

What statistical approaches are best for analyzing BIK-induced apoptosis data?

Statistical analysis of BIK-induced apoptosis data should be tailored to experimental design and research questions:

For Comparing Treatment Groups:

  • t-tests: For comparing two experimental conditions (e.g., with/without BIK expression)

  • ANOVA with post-hoc tests: For experiments with multiple conditions or time points

  • Non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis): When normality assumptions are violated

For Dose-Response Relationships:

  • Regression analysis: Linear or non-linear models depending on response pattern

  • EC50 determination: Calculate half-maximal effective concentration

  • Hill slope analysis: Evaluate cooperativity in response

For Time-Course Experiments:

  • Repeated measures ANOVA: Account for within-subject correlation

  • Survival analysis: For time-to-event data (e.g., time until apoptosis)

  • Area under curve (AUC) analysis: Integrate response over time

Special Considerations:

  • Control for nuisance factors using randomized block designs

  • Apply multiple testing corrections when performing numerous comparisons

  • Ensure adequate sample size through power analysis

Results should be presented with appropriate measures of central tendency and dispersion, and graphical representations should include error bars indicating statistical uncertainty. Statistical significance alone is insufficient; effect sizes should be reported to indicate biological relevance.

How can I distinguish between direct and indirect effects of BIK in cellular assays?

Distinguishing direct from indirect effects of BIK requires experimental strategies that isolate specific mechanisms:

Mechanism Isolation Approaches:

  • Timing analysis: Direct effects typically occur more rapidly than downstream consequences

  • Inhibitor studies: Block specific pathways to determine which are essential for observed effects

  • Genetic manipulation: Use knockout/knockdown models of suspected mediators

Specific Techniques:

  • BIK mutants: Compare wild-type BIK with binding-deficient mutants to identify interaction-dependent effects

  • Subcellular localization alterations: Redirect BIK to different compartments using targeting sequences

  • Inducible expression systems: Control timing and level of BIK expression for temporal dissection of events

Analytical Framework:

  • Causal mediation analysis: Statistically evaluate whether effects operate through hypothesized mediators

  • Hierarchical testing: Systematically test nested hypotheses about mechanisms

  • Pathway reconstruction: Build models of sequential events and test predictions

When analyzing results, consider both direct biochemical interactions and downstream signaling cascades. A change in binding constants (Kd) for BIK interactions with its partners provides evidence for direct effects , while changes in distal events (e.g., caspase activation) without corresponding proximal changes may indicate indirect mechanisms.

How can I address low expression or toxicity when producing recombinant BIK?

The pro-apoptotic nature of BIK creates challenges for recombinant expression that require strategic solutions:

Expression System Optimization:

  • Inducible expression systems: Use tightly regulated promoters (tetracycline-inducible, rhamnose-inducible) to control expression timing and level

  • Expression hosts: Consider specialized strains designed for toxic proteins (C41/C43 bacterial strains, BL21(DE3) pLysS)

  • Co-expression strategies: Express anti-apoptotic proteins (Bcl-2, Bcl-XL) alongside BIK to neutralize toxicity

Construct Modifications:

  • Inactive mutants: Introduce mutations that temporarily disable pro-apoptotic function during expression

  • Fusion partners: Use solubility-enhancing tags (MBP, SUMO, TRX) that may also reduce toxicity

  • Truncated constructs: Express functional domains rather than full-length protein

Expression Conditions:

  • Reduced temperature: Lower to 16-18°C during induction phase

  • Limited induction: Use minimal inducer concentrations and shorter induction times

  • Media optimization: Rich media with osmotic stabilizers can improve cell viability

Purification Considerations:

  • Rapid processing: Minimize time between cell disruption and purification steps

  • Protease inhibitors: Include comprehensive inhibitor cocktails to prevent degradation

  • Stabilizing additives: Incorporate glycerol, arginine, or mild detergents in buffers

These strategies can be systematically tested using small-scale expression trials before proceeding to large-scale production for experiments.

What are best practices for analyzing BIK effects in heterogeneous cell populations?

Heterogeneous cell populations present unique challenges for analyzing BIK effects that require specialized approaches:

Single-Cell Analysis Methods:

  • Flow cytometry: Quantify apoptotic markers at single-cell resolution

  • Mass cytometry (CyTOF): Simultaneously measure multiple parameters including BIK expression and apoptotic markers

  • Single-cell imaging: Track individual cell responses over time using live-cell microscopy

Population Segregation Strategies:

  • Cell sorting: Isolate subpopulations based on BIK expression or apoptotic state

  • Selective labeling: Use pulse-chase approaches to track specific subpopulations

  • Barcoding techniques: Uniquely label different cell types before mixing and analysis

Analytical Approaches:

  • Mixture modeling: Statistically deconvolute heterogeneous population responses

  • Trajectory analysis: Map cellular transitions between states

  • Correlation analysis: Identify relationships between BIK expression and phenotypic outcomes

When designing experiments with heterogeneous populations, randomized block designs can help control for nuisance factors that might affect subpopulations differently . Additionally, ensure adequate sampling to capture rare cell populations that might have distinct responses to BIK.

How can I ensure reproducibility in BIK research across different experimental systems?

Ensuring reproducibility in BIK research requires standardized approaches that minimize variability:

Standardization Practices:

  • Detailed protocols: Document all experimental procedures with precise parameters

  • Validation of key reagents: Confirm identity and activity of recombinant proteins, antibodies, and cell lines

  • Reference standards: Include consistent positive and negative controls across experiments

Critical Parameters to Control:

  • Protein quality: Assess purity, folding, and functional activity before experiments

  • Cell culture conditions: Standardize passage number, confluence, and growth conditions

  • Transfection/transduction efficiency: Normalize for expression levels when comparing BIK effects

Reproducibility Assessment:

  • Independent replication: Perform key experiments by different researchers

  • Cross-platform validation: Confirm findings using alternative technical approaches

  • Inter-laboratory testing: Collaborate to verify results in different settings

Reporting Practices:

  • Follow structured reporting guidelines for apoptosis research

  • Include complete methodological details, including seemingly minor variables

  • Provide raw data and analysis scripts when publishing

To assess the reliability of evidence across different experimental systems, apply GRADE principles to evaluate the certainty of findings based on risk of bias, inconsistency, indirectness, imprecision, and publication bias . This structured assessment helps identify which findings are most robust across different experimental contexts.

What emerging technologies could advance BIK interaction studies?

Emerging technologies offer new opportunities to understand BIK interactions with unprecedented detail:

Advanced Imaging Technologies:

  • Super-resolution microscopy: Visualize BIK localization and interactions below the diffraction limit

  • FLIM-FRET with improved sensors: Enhanced fluorophores and detection systems for more sensitive interaction measurements

  • Correlative light and electron microscopy (CLEM): Connect functional imaging with ultrastructural analysis

Protein Engineering Approaches:

  • Optogenetic BIK variants: Light-controlled activation to study temporal dynamics

  • Expanded genetic code incorporation: Site-specific labeling for precise interaction mapping

  • Cyclic peptide libraries: Develop selective modulators of specific BIK interactions

High-Throughput Screening Technologies:

  • CRISPR-based genetic screens: Identify genes affecting BIK function

  • Protein microarrays: Screen BIK interactions against thousands of proteins simultaneously

  • Deep mutational scanning: Systematically map how mutations affect BIK function

Computational Approaches:

  • Molecular dynamics simulations: Model BIK interactions in membrane environments

  • Machine learning for interaction prediction: Develop algorithms to predict binding partners and affinities

  • Systems biology modeling: Integrate BIK into apoptotic pathway models

These technologies promise to provide more quantitative, spatially resolved, and physiologically relevant information about BIK interactions within the complex cellular environment.

How can conflicting data about BIK function be reconciled into a coherent model?

Reconciling conflicting data about BIK function requires a systematic approach to integrate diverse findings:

Data Integration Strategies:

  • Context-dependent modeling: Develop frameworks that specify conditions under which particular interactions/functions predominate

  • Bayesian network analysis: Integrate probabilistic relationships between variables affecting BIK function

  • Systematic review methodology: Apply structured approaches to evaluate evidence quality across studies

Resolution Frameworks:

  • Hierarchical hypothesis testing: Systematically evaluate nested hypotheses about mechanisms

  • Contradictions as boundary conditions: Reframe contradictions as defining the limits of specific models

  • Identification of missing variables: Seek unidentified factors that explain apparent contradictions

Experimental Validation:

  • Critical experiment design: Develop definitive tests that can discriminate between competing models

  • Parameter space mapping: Systematically explore conditions that transition between different BIK functions

  • Predictive testing: Generate and test novel predictions from integrated models

What are the key methodological advances needed to better understand BIK in the membrane context?

Understanding BIK function in membrane contexts requires methodological innovations addressing several challenges:

Membrane Mimetics Development:

  • Improved nanodiscs: Better recapitulate native membrane environments

  • Cell-derived vesicles: Preserve natural lipid composition and membrane proteins

  • 3D-printed membrane systems: Create defined membrane topologies and compositions

Biophysical Analysis Advances:

  • Single-molecule techniques: Monitor individual BIK molecules in membranes

  • High-resolution structure determination: Solve membrane-bound BIK structures

  • Native mass spectrometry: Analyze intact membrane protein complexes

Cellular Imaging Innovations:

  • Correlative microscopy workflows: Connect functional imaging with structural analysis

  • Membrane tension and curvature sensors: Monitor physical properties during BIK action

  • Improved fluorescent membrane probes: Better visualize membrane changes

Computational Methods:

  • Enhanced membrane protein simulation: Model BIK-membrane interactions more accurately

  • Integration of multiple data types: Combine structural, functional, and cellular data

  • Multiscale modeling: Connect molecular interactions to cellular outcomes

These methodological advances would address a critical gap in our understanding of how the membrane environment influences BIK function. The importance of membrane context is highlighted by recent findings about the role of C-terminal sequences in Bcl-2 family proteins, which mediate not just membrane localization but also critical protein-protein interactions that regulate MOMP .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.