Recombinant Human Bcl-2-like protein 13 (BCL2L13)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its inclusion during production.
Synonyms
BCL2L13; MIL1; CD003; Bcl-2-like protein 13; Bcl2-L-13; Bcl-rambo; Protein Mil1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-485
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MASSSTVPLGFHYETKYVVLSYLGLLSQEKLQEQHLSSPQGVQLDIASQSLDQEILLKVK TEIEEELKSLDKEISEAFTSTGFDRHTSPVFSPANPESSMEDCLAHLGEKVSQELKEPLH KALQMLLSQPVTYQAFRECTLETTVHASGWNKILVPLVLLRQMLLELTRRGQEPLSALLQ FGVTYLEDYSAEYIIQQGGWGTVFSLESEEEEYPGITAEDSNDIYILPSDNSGQVSPPES PTVTTSWQSESLPVSLSASQSWHTESLPVSLGPESWQQIAMDPEEVKSLDSNGAGEKSEN NSSNSDIVHVEKEEVPEGMEEAAVASVVLPARELQEALPEAPAPLLPHITATSLLGTREP DTEVITVEKSSPATSLFVELDEEEVKAATTEPTEVEEVVPALEPTETLLSEKEINAREES LVEELSPASEKKPVPPSEGKSRLSPAGEMKPMPLSEGKSILLFGGAAAVAILAVAIGVAL ALRKK
Uniprot No.

Target Background

Function
May promote caspase-3 activation and apoptosis.
Gene References Into Functions

Functional Studies of Bcl-2-like protein 13 (BCL2L13):

  1. Ectopically expressed in Drosophila, Bcl-rambo (a related protein) localizes to mitochondria, induces apoptosis, and results in atrophied wings, split thorax, and rough eye phenotypes. PMID: 27348811
  2. Bcl-2-like protein 13 (Bcl2-L-13) induces mitochondrial fragmentation and mitophagy in mammalian cells. PMID: 26146385
  3. Bcl2L13 interacts with proapoptotic ceramide synthases 2 (CerS2) and 6 (CerS6), inhibiting their complex formation and activity. PMID: 24706805
  4. Bcl-rambo, a pro-apoptotic Bcl-2 family member, induces permeability transition through interaction with the adenine nucleotide translocator (ANT). PMID: 22921587
  5. Alu element insertion during splicing may contribute to protein diversity in primate cells. PMID: 12527362
  6. SidF counteracts apoptosis in Legionella pneumophila-infected cells by interacting with and neutralizing the pro-apoptotic effects of BNIP3 and Bcl-rambo. PMID: 17360363
Database Links

HGNC: 17164

KEGG: hsa:23786

STRING: 9606.ENSP00000318883

UniGene: Hs.631672

Protein Families
Bcl-2 family
Subcellular Location
[Isoform 2]: Mitochondrion membrane; Single-pass membrane protein. Nucleus.; [Isoform 1]: Nucleus.
Tissue Specificity
Ubiquitous, with the highest levels of expression in heart, placenta and pancreas.

Q&A

What distinguishes BCL2L13 from other BCL-2 family members structurally?

The BH domains are crucial for mitochondrial fragmentation activities, while the WXXI motif facilitates mitophagy through direct interaction with LC3 . This structural arrangement allows BCL2L13 to function as both an apoptosis regulator and a mitophagy receptor, highlighting its versatility in cellular homeostasis.

How does BCL2L13 function as a mitophagy receptor?

BCL2L13 serves as a mammalian functional homolog of yeast Atg32, a critical mitophagy receptor. It binds directly to LC3 through its WXXI motif, facilitating the targeting of mitochondria to autophagosomes for degradation . Notably, BCL2L13 can induce mitophagy independently of the canonical PINK1/Parkin pathway, as it induces mitophagy in Parkin-deficient cells .

The protein also induces mitochondrial fragmentation even in the absence of Drp1 (a primary mediator of mitochondrial fission), indicating a unique mechanism of action . In biological contexts like glioblastoma, BCL2L13 targets DNM1L at the Ser616 site, leading to mitochondrial fission and high mitophagy flux that promotes cancer cell survival and invasiveness . Knockdown of BCL2L13 attenuates mitochondrial damage-induced fragmentation and mitophagy, confirming its essential role in this quality control process .

What experimental systems are most suitable for studying native BCL2L13 functions?

For studying native BCL2L13 functions, researchers should consider:

  • Cell line selection: Cell types with moderate to high endogenous BCL2L13 expression are ideal, including:

    • Glioblastoma cell lines (U251, GBM#P3, GBM#BG5)

    • Acute myeloid leukemia cells (Mono Mac 6, THP-1)

    • Adipogenic precursors (3T3-L1 cells, ear mesenchymal stem cells)

  • Primary cell models: Bone marrow stromal cells (BMSCs) offer a physiologically relevant model, particularly for studying BCL2L13's role in adipogenic differentiation .

  • Functional readouts: Depending on the specific BCL2L13 function under investigation:

    • Mitophagy: Mitochondrial fragmentation analysis, co-localization with LC3, mitophagy flux measurement

    • Apoptosis: Flow cytometry with Annexin V/PI staining, caspase activity assays

    • Ceramide metabolism: Lipidomic analyses, CerS activity assays

    • Adipogenesis: Oil Red O staining, adipocyte marker gene expression (Pparg, Adipoq, Fabp4)

Genetic manipulation through knockdown approaches (shRNA/siRNA) allows for loss-of-function studies, while tagged overexpression systems help elucidate interaction partners and subcellular localization .

What are the recommended methods for BCL2L13 gene knockdown and validation?

Effective BCL2L13 knockdown can be achieved through several approaches:

shRNA-Mediated Stable Knockdown:

  • Lentiviral delivery is most effective, with selection using 4 μg/mL puromycin to establish stable clones

  • Multiple shRNA sequences should be tested, with sh-BCL2L13#2 and #3 showing particularly effective knockdown in glioblastoma cells

  • Validation requires both qRT-PCR (for mRNA reduction) and western blot (for protein reduction, typically showing 50-90% decrease)

siRNA for Transient Knockdown:

  • Transfection of cells with siRNA targeting BCL2L13 shows effective knockdown after 3-6 days

  • Validation demonstrates ~90% reduction in expression after 3 days, decreasing to ~54% reduction by day 6

Functional Validation Approaches:

  • Morphological assessment (e.g., changes in mitochondrial networks)

  • Specific functional assays (e.g., decreased Oil Red O staining in adipogenic models)

  • Expression analysis of downstream targets (e.g., decreased Pparg during adipogenesis)

  • Cell viability assays (e.g., CCK-8 assay showing reduced viability in cancer cells)

For comprehensive validation, combine multiple approaches including protein and mRNA quantification alongside functional readouts specific to the cell type and pathway being studied.

How can researchers effectively study BCL2L13 interactions with ceramide synthases?

To study BCL2L13-ceramide synthase interactions, researchers should employ these methodological approaches:

Co-Immunoprecipitation (Co-IP):

  • Cell lysis using appropriate buffer (20 mM Tris-HCl, pH 7.5, 150 mM NaCl, 1% NP-40, 0.5% sodium deoxycholate, 1 mM EDTA, 1 mM PMSF, 10% glycerol, with protease/phosphatase inhibitors)

  • Pre-clear lysates with Protein A/G agarose beads

  • Incubate overnight at 4°C with anti-BCL2L13 antibody

  • Capture with fresh beads (2-hour incubation)

  • Wash immunocomplexes thoroughly and elute in 2X SDS-PAGE sample buffer

  • Analyze by western blot using antibodies against CerS2 and CerS6

  • Perform densitometry to quantify interaction intensity

Yeast Two-Hybrid (Y2H) Screening:

  • Clone full-length BCL2L13 into bait construct (GAL4 DNA-binding domain-pGBKT7)

  • Transform into S. cerevisiae Y2HGold strain

  • Confirm expression in transformed yeast by western blot

  • For prey, use human cDNA libraries (e.g., fetal brain) constructed in pGADT7-Rec vector

  • Perform mating and select colonies on stringency-selection media

  • Analyze positive colonies by PCR amplification and sequencing

Mutational Analysis:
To map interaction domains, researchers should create truncation or point mutations in the unique C-terminal 250-aa sequence (BHNo domain) of BCL2L13, as this region has been identified as critical for binding to CerS2 and CerS6 .

What are the most sensitive methods for analyzing BCL2L13-mediated effects on ceramide metabolism?

To analyze BCL2L13-mediated effects on ceramide metabolism with high sensitivity, researchers should consider these approaches:

Lipidomic Analysis by LC-MS/MS:

  • Extract cellular lipids using modified Bligh-Dyer or similar methods

  • Separate ceramide species by liquid chromatography

  • Identify and quantify using tandem mass spectrometry

  • Include internal standards for specific ceramide species (particularly Cer 16:0, 18:0, 20:0, 22:0, 24:0, and 24:1)

  • Compare profiles between BCL2L13 wildtype and knockdown/overexpression conditions

CerS Activity Assays:

  • Prepare microsomes from cells with varying BCL2L13 expression

  • Incubate with sphinganine and specific acyl-CoAs corresponding to each CerS preference

  • Measure formation of dihydroceramides as readout of activity

  • Correlate CerS activity with BCL2L13 expression/binding

Functional Ceramide Metabolism Readouts:

  • Assess apoptosis sensitivity to ceramide-generating treatments

  • Measure cell viability responses to exogenous ceramides

  • Analyze ceramide-dependent signaling pathway activation

When interpreting results, note that in glioblastoma, BCL2L13 shows differential interactions with CerS6 (increased) and CerS2 (decreased) in TMZ-resistant versus non-resistant cells, correlating with altered ceramide profiles . BCL2L13 knockdown does not always predictably alter ceramide levels, suggesting compensatory mechanisms may exist .

What protocols are recommended for studying BCL2L13's role in mitophagy?

For comprehensive analysis of BCL2L13's role in mitophagy, employ these protocols:

Mitochondrial Fragmentation Analysis:

  • Transfect cells with mitochondrial markers (e.g., mito-GFP)

  • Capture live-cell images using confocal microscopy

  • Quantify mitochondrial morphology parameters (length, width, circularity)

  • Compare between BCL2L13 wildtype, knockdown, and overexpression conditions

Mitophagy Flux Assessment:

  • Assess autophagosome accumulation through LC3βII western blotting

  • Evaluate SQSTM1/p62 levels as markers of autophagy flux

  • Use lysosomal inhibitors (Bafilomycin A1, Chloroquine) to differentiate between enhanced formation versus reduced clearance

Microscopy-Based Mitophagy Quantification:

  • Use dual-fluorescence reporters (mt-Keima, mito-QC) or tandem-tagged LC3 (mCherry-GFP-LC3)

  • Visualize mitophagy events as mCherry-positive red spots in confocal images

  • Quantify using ImageJ or similar software to calculate mitophagy/mitochondria ratios

  • Include positive controls (mitophagy inducers like CCCP or deferiprone)

Biochemical Mitophagy Analyses:

  • Measure mitochondrial DNA content relative to nuclear DNA

  • Assess mitochondrial/nuclear DNA ratios (Mt/N) during processes like adipogenesis

  • Analyze expression of mitochondrial fusion proteins (e.g., MFN2)

  • Evaluate mitochondrial mass using MitoTracker or mitochondrial proteins

The methods should be used in combination to distinguish BCL2L13-specific effects from general autophagy or mitochondrial dynamics changes.

How does BCL2L13 expression vary across cancer types, and what are the functional implications?

BCL2L13 expression shows striking variations across cancer types with significant functional implications:

Overexpression in:

  • Glioblastoma (GBM):

    • Significantly upregulated in GBM cell lines and clinical samples

    • Higher in mesenchymal subtype compared to proneural or neural subtypes

    • Promotes cell proliferation, invasion, and resistance to apoptosis

    • Enhances survival through mitophagy regulation

  • Acute Myeloid Leukemia (AML):

    • Strikingly augmented expression

    • Inhibits apoptosis, promoting cancer cell survival

    • Associated with chemotherapeutic resistance

    • Correlates with unfavorable clinical outcomes

  • Acute Lymphoblastic Leukemia (ALL):

    • Overexpression associated with chemotherapeutic resistance

    • Identified as prognostic factor for unfavorable clinical outcome among apoptosis-related genes

Downregulation in:

  • Renal Cell Carcinoma:

    • Significantly decreased in clear cell (ccRCC) and papillary (pRCC) subtypes

    • Down-regulation correlates with poor prognosis

    • Effect is independent of gender or tumor grade

    • Functions independent of well-known kidney cancer-related genes

The Cancer Cell Line Encyclopedia (CCLE) data indicates that glioma cell lines possess higher BCL2L13 expression than most cancer cell lines from other lineages . This differential expression pattern suggests context-dependent functions that may reflect tissue-specific roles in mitochondrial quality control and apoptosis regulation.

What mechanisms underlie BCL2L13's role in temozolomide resistance in glioblastoma?

BCL2L13 contributes to temozolomide (TMZ) resistance in glioblastoma through multiple interrelated mechanisms:

Disruption of Ceramide Metabolism:

  • BCL2L13 binds to and inhibits pro-apoptotic ceramide synthases (CerS2 and CerS6)

  • This interaction blocks homo- and heteromeric CerS2/6 complex formation and activity

  • In TMZ-resistant cells, BCL2L13 shows increased interaction with CerS6 and reduced interaction with CerS2 compared to TMZ-non-resistant cells

  • The resulting altered ceramide profile (elevated levels of Cer 16:0, 18:0, 20:0, 22:0, 24:0, and 24:1) contributes to resistance mechanisms

Autophagy Flux Modulation:

  • Complete inhibition of autophagy flux in TMZ-resistant cells, indicated by LC3βII and SQSTM1 accumulation

  • BCL2L13 knockdown disrupts this pattern, decreasing autophagosome accumulation in TMZ-resistant cells

  • These changes in autophagy dynamics influence cell survival under treatment conditions

Apoptosis Inhibition:

  • BCL2L13 prevents TMZ-induced apoptosis, allowing cancer cells to maintain viability

  • Flow cytometry analysis shows that TMZ-resistant cells maintain viability while TMZ-non-resistant cells exhibit heightened sensitivity to TMZ-induced apoptosis

Mitochondrial Dynamics Regulation:

  • BCL2L13 promotes mitophagy through DNM1L-mediated mitochondrial fission

  • This quality control mechanism helps cancer cells adapt to treatment-induced stress

  • The resulting mitochondrial network changes support cellular bioenergetics under therapy

These mechanisms collectively contribute to the adaptive response that allows glioblastoma cells to survive and proliferate despite TMZ treatment.

How might BCL2L13 be therapeutically targeted in cancer?

Based on its roles in cancer biology, BCL2L13 offers several promising therapeutic targeting strategies:

Direct Inhibition Approaches:

  • BHNo Domain Targeting:

    • Develop small molecules that specifically bind the unique C-terminal 250-aa sequence

    • This could disrupt BCL2L13's interaction with ceramide synthases without affecting other BCL-2 family proteins

    • Particularly relevant for glioblastoma and leukemia where BCL2L13 is overexpressed

  • WXXI Motif Disruption:

    • Design peptides or small molecules that interfere with LC3 binding

    • This would impair BCL2L13's mitophagy receptor function

    • Could synergize with therapies that induce mitochondrial damage

Combination Therapy Approaches:

  • Sensitization to Standard Therapies:

    • In glioblastoma, BCL2L13 inhibition could restore sensitivity to TMZ

    • BCL2L13 knockdown increases apoptotic cell death in GBM cells, suggesting therapeutic potential

  • Ceramide Metabolism Modulation:

    • Combine BCL2L13 inhibition with agents that increase ceramide levels

    • This would counter BCL2L13's inhibition of ceramide synthases

    • Could particularly enhance apoptotic responses in therapy-resistant cancers

Context-Specific Approaches:

  • Cancer Type Considerations:

    • For GBM and leukemia: inhibit BCL2L13 to promote apoptosis

    • For renal cell carcinoma: consider approaches to restore BCL2L13 expression or function

  • Biomarker-Guided Therapy:

    • Use BCL2L13 expression levels as predictive biomarkers for therapy response

    • Develop companion diagnostics to identify patients likely to benefit from BCL2L13-targeting approaches

Therapeutic development should consider BCL2L13's dual roles in both cancer promotion and suppression depending on cellular context, necessitating careful patient selection and monitoring of mitochondrial function.

How does BCL2L13 regulate the balance between mitophagy and apoptosis?

BCL2L13 functions as a crucial regulator at the intersection of mitophagy and apoptosis pathways:

Dual Role Integration:

  • As a mitophagy receptor, BCL2L13 promotes mitochondrial quality control through selective degradation of damaged mitochondria via direct binding to LC3

  • As an apoptosis regulator, it either promotes or inhibits apoptosis depending on cellular context

  • This dual functionality allows BCL2L13 to serve as a decision point between quality control (mitophagy) and cell death (apoptosis)

Contextual Switching Mechanisms:

  • In adipogenic differentiation, BCL2L13 suppresses apoptosis while promoting mitophagy, allowing cells to survive differentiation processes while maintaining mitochondrial quality

  • In cancer contexts (GBM, AML), elevated BCL2L13 inhibits apoptosis through ceramide synthase inhibition while maintaining mitophagy, promoting therapy resistance

  • In renal carcinoma, reduced BCL2L13 correlates with poor prognosis, suggesting its apoptosis-promoting function may predominate in this tissue context

Molecular Mediators of Balance:

  • Interaction with ceramide synthases (CerS2/6) inhibits pro-apoptotic ceramide production

  • DNM1L phosphorylation at Ser616 promotes mitochondrial fission and subsequent mitophagy

  • SLC25A4 (ANT1) acts as a downstream effector in BCL2L13's pro-apoptotic pathway in some contexts

This balance regulation appears to be dynamically responsive to cellular stress and metabolic states, allowing adaptive responses that maintain cellular homeostasis or facilitate pathological processes like therapy resistance.

What is the relationship between BCL2L13 expression and mitochondrial metabolism in different cellular contexts?

BCL2L13 expression demonstrates significant context-dependent relationships with mitochondrial metabolism:

In Adipocyte Differentiation:

  • BCL2L13 expression increases progressively during adipogenesis, following a pattern similar to adipocyte marker genes (Pparg and Adipoq)

  • This increase correlates with enhanced mitochondrial biogenesis, shown by increased mitochondrial/nuclear DNA ratio (Mt/N)

  • Leads to significant increases in mitochondrial fusion protein mitofusin-2 (MFN2)

  • Promotes oxidative phosphorylation, essential for adipocyte differentiation

  • BCL2L13 knockdown reprograms cells to rely more on glycolysis for ATP generation

In Cancer Contexts:

  • In glioblastoma, elevated BCL2L13 targets DNM1L at Ser616, promoting mitochondrial fission and high mitophagy flux

  • This altered dynamics supports cancer cell proliferation and invasion

  • In TMZ-resistant glioblastoma cells, BCL2L13 contributes to autophagy flux inhibition, affecting mitochondrial turnover

  • The resulting mitochondrial adaptations support cancer cell survival under therapeutic stress

Metabolic Programming:

  • BCL2L13 appears to influence genetic programming of metabolism for lineage determination

  • In bone marrow stromal cells, BCL2L13 promotes adipogenesis by increasing oxidative phosphorylation

  • This programming may be important for cell function within specific tissues

The data collectively suggest BCL2L13 functions as an important regulator of mitochondrial dynamics and metabolic programming, with effects that vary based on cellular differentiation state and tissue context.

What is the significance of BCL2L13's evolutionary relationship to yeast Atg32?

The identification of BCL2L13 as a mammalian homolog of yeast Atg32 has significant evolutionary and functional implications:

Functional Conservation:

  • BCL2L13 induces mitophagy in Atg32-deficient yeast cells, demonstrating functional complementation across evolutionary boundaries

  • Like Atg32, BCL2L13 serves as a direct mitophagy receptor, binding to autophagic machinery (LC3 in mammals, Atg8 in yeast)

  • This conservation indicates the fundamental importance of selective mitochondrial autophagy across eukaryotic evolution

Structural Evolution:

  • While maintaining core mitophagy receptor functions, BCL2L13 has acquired additional domains not present in Atg32:

    • Four BCL-2 homology domains (BH1-4)

    • A unique C-terminal 250-aa sequence (BHNo domain)

  • These structural additions suggest expanded functionality in mammals, including roles in apoptosis regulation and ceramide metabolism

Evolutionary Complexity:

  • Unlike yeast with a single mitophagy receptor (Atg32), mammals have evolved multiple mitophagy receptors (BNIP3, NIX, FUNDC1, and BCL2L13)

  • This diversification likely reflects increased complexity of mitochondrial networks and quality control needs in higher organisms

  • The integration of mitophagy with apoptosis regulation represents an evolutionary innovation in mammalian systems

The BCL2L13-Atg32 relationship provides a compelling example of how core cellular quality control mechanisms have been conserved while gaining additional regulatory complexity during eukaryotic evolution.

How do the tissue-specific functions of BCL2L13 relate to its varied expression patterns?

BCL2L13 demonstrates significant tissue-specific functions that correlate with its expression patterns:

Bone Marrow and Adipose Tissue:

  • Higher expression in bone marrow stromal cells (BMSCs) from C3H mice compared to B6 mice

  • Expression increases during adipogenic differentiation but not osteogenic differentiation

  • Functions to promote adipogenesis through:

    • Enhanced oxidative phosphorylation

    • Suppression of apoptosis

    • Mitochondrial quality control through mitophagy

  • May be influenced by genetic background factors, including a chromosomal inversion in C3H/HeJ mice

Brain and Neural Tissue:

  • In glioblastoma, BCL2L13 is highly expressed with increasing levels correlating with tumor grade

  • Expression associates with the mesenchymal subtype, which has poorer outcomes

  • Functions to promote therapy resistance through ceramide synthase inhibition

  • Supports tumor cell proliferation and invasion through mitochondrial dynamics regulation

Hematopoietic System:

  • Highly expressed in acute myeloid leukemia (AML) cells

  • Inhibits apoptosis, promoting cancer cell survival

  • Overexpression associated with chemotherapeutic resistance in childhood acute lymphoblastic leukemia (ALL)

Kidney:

  • Expression significantly decreased in clear cell (ccRCC) and papillary (pRCC) renal cell carcinoma

  • Down-regulation correlates with poor prognosis

  • Functions as a potential tumor suppressor through pro-apoptotic activity

  • Associated with SLC25A4 as a downstream effector in its pro-apoptotic pathway

These varied expression patterns and functions suggest BCL2L13 has evolved tissue-specific roles that may relate to the particular metabolic and quality control needs of different cell types.

What are the current limitations in BCL2L13 research methodologies?

Current BCL2L13 research faces several methodological challenges:

Expression System Limitations:

  • Transient overexpression systems may create artifacts due to non-physiological protein levels

  • Initial reports using standard 293T-based transient overexpression suggested proapoptotic functions, while endogenous studies in cancer cells often show anti-apoptotic effects

  • Cell-type-specific functions make it difficult to generalize findings across experimental systems

Antibody and Detection Issues:

  • Limited availability of validated, specific antibodies for different applications (Western blot, immunoprecipitation, immunohistochemistry)

  • Challenges in detecting endogenous protein due to expression level variations across cell types

  • Mitochondrial localization can complicate extraction and analysis procedures

Functional Assay Complexities:

  • Difficulty distinguishing BCL2L13-specific mitophagy from general autophagy or mitochondrial dynamics

  • Challenges in measuring ceramide synthase inhibition in intact cells

  • Temporal aspects of mitophagy and apoptosis regulation often overlooked in fixed-timepoint analyses

Model System Limitations:

  • Lack of genetically engineered mouse models specifically for BCL2L13

  • Limited understanding of BCL2L13 regulation under physiological and pathological conditions

  • Cellular contexts used in studies may not fully recapitulate in vivo functions

Future methodological improvements should include development of conditional knockout models, better antibodies and detection systems, and live-cell approaches to understand the dynamic regulation of BCL2L13 functions.

What are the most promising directions for future BCL2L13 research?

Several promising research directions could significantly advance our understanding of BCL2L13:

Structural and Mechanistic Studies:

  • Detailed structural analysis of the unique BHNo domain to understand its interaction with ceramide synthases

  • Investigation of post-translational modifications that regulate BCL2L13 activity, particularly potential phosphorylation sites

  • Deeper understanding of how BCL2L13 induces mitochondrial fragmentation in Drp1-independent contexts

Cancer Biology Applications:

  • Development of BCL2L13 as a biomarker for therapy resistance in glioblastoma and leukemia

  • Exploration of BCL2L13-targeting approaches to overcome TMZ resistance

  • Investigation of the paradoxical tumor suppressor role in renal carcinoma versus oncogenic function in brain tumors

Metabolic Regulation Studies:

  • Further characterization of BCL2L13's role in metabolic programming during cellular differentiation

  • Investigation of its potential involvement in metabolic disorders beyond cancer

  • Exploration of the relationship between mitochondrial dynamics, metabolism, and BCL2L13 expression

Therapeutic Development:

  • Design of small molecules targeting the BHNo domain to disrupt ceramide synthase interactions

  • Development of peptide-based approaches to interfere with LC3 binding

  • Exploration of combination therapies that exploit BCL2L13's role in therapy resistance

Systems Biology Approaches:

  • Comprehensive interactome mapping to identify all BCL2L13 binding partners

  • Integration of transcriptomic, proteomic, and metabolomic data to understand BCL2L13's global effects

  • Network analysis to position BCL2L13 within cellular stress response pathways

These directions could significantly advance both basic science understanding and translational applications of BCL2L13 research.

How might conflicting findings on BCL2L13 function be reconciled through improved experimental design?

To reconcile conflicting findings on BCL2L13 function, researchers should implement these experimental design improvements:

Standardized Expression Systems:

  • Develop inducible expression systems with titratable expression levels

  • Compare effects at physiological versus overexpression levels

  • Use isogenic cell lines to control for genetic background effects

  • Include domain mutants to dissect specific functions (e.g., WXXI motif mutants versus BH domain mutants)

Comprehensive Functional Assessment:

  • Simultaneously measure multiple parameters:

    ParameterMethodologyControl/Comparison
    ApoptosisAnnexin V/PI, caspase activationWith/without apoptotic stimuli
    Mitophagymt-Keima, LC3 co-localizationWith/without mitophagy inducers
    Ceramide metabolismLipidomic analysisWith/without ceramide synthase modulators
    Mitochondrial dynamicsLive-cell imagingWith/without fission/fusion protein knockdowns
  • Assess temporal dynamics through time-course experiments rather than single timepoints

Context-Specific Analysis:

  • Compare BCL2L13 functions across multiple cell types within the same study

  • Include primary cells alongside established cell lines

  • Consider tissue microenvironment factors (hypoxia, nutrient availability)

  • Address how cell cycle phase affects BCL2L13 function

Interaction Partner Assessment:

  • Determine the relative abundance of key binding partners (CerS2/6, LC3) in each experimental system

  • Create interaction maps showing how BCL2L13 binding partners vary by cell type

  • Assess how forced expression of specific interaction partners affects BCL2L13 function

Combinatorial Genetic Approaches:

  • Perform epistasis experiments (e.g., combining BCL2L13 knockdown with CerS2/6 manipulation)

  • Use CRISPR interference or activation to modulate BCL2L13 at endogenous loci

  • Combine BCL2L13 modulation with knockdown of mitophagy or apoptosis pathway components

By implementing these approaches, researchers can begin to build a unified model of BCL2L13 function that accounts for its context-dependent roles across cellular systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.