Recombinant Human Bestrophin-1 (BEST1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Human Bestrophin-1

Recombinant Human BEST1 is produced through heterologous expression systems to study its channel activity, structure, and disease-associated mutations. Key features include:

PropertyDetails
Gene ID7439 (Human)
Protein Length585 amino acids (full-length) , 317 aa (truncated forms)
Molecular Weight68 kDa (native) ; 36 kDa (truncated recombinant forms)
Expression SystemsE. coli , Wheat germ
Common TagsN-terminal His-tag
Key Domains4–6 transmembrane regions, conserved N-terminus

Expression Systems

  • E. coli: Used by ProSpec Bio and Creative BioMart to produce truncated BEST1 (residues 292–585) with a 36 kDa molecular weight .

  • Wheat germ: Employed by Abcam for full-length BEST1 (1–604 aa), retaining native-like post-translational modifications .

Purification and Stability

  • Purified via affinity chromatography (His-tag) .

  • Storage: Stable at -20°C in Tris-HCl buffer (pH 8.0) with 10% glycerol; carrier proteins (e.g., BSA) recommended for long-term storage .

Channel Activity

  • Acts as a calcium- and volume-regulated chloride/bicarbonate channel .

  • Permeability: Chloride > bicarbonate .

  • Pathological relevance: Loss of CaCC activity in RPE correlates with Best disease phenotypes .

Disease Modeling

  • Y227N mutation: Reduces protein half-life in testis, causing reproductive deficits in knock-in mice .

  • P274R mutation: Abolishes CaCC currents in patient-derived RPE cells, reversible via viral gene supplementation .

Gene Therapy

  • Loss-of-function mutations: Rescue achievable with wild-type BEST1 overexpression (e.g., AAV-mediated delivery) .

  • Gain-of-function mutations: Require CRISPR/Cas9 knockdown of mutant alleles alongside gene augmentation .

Drug Development

  • Recombinant BEST1 enables high-throughput screening for channel modulators .

  • Challenges include mutation-specific rescue strategies and avoiding dominant-negative effects in heteromeric channels .

Future Directions

  • Elucidating structural dynamics of disease-associated mutants .

  • Developing allele-specific therapies for dominant mutations .

  • Expanding in vivo models to assess long-term efficacy of gene therapies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will fulfill your request accordingly.
Lead Time
Delivery time may vary based on the purchasing method or location. Kindly consult your local distributors for specific delivery details.
Note: Our standard shipping includes blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development according to your preference.
Synonyms
BEST1; VMD2; Bestrophin-1; TU15B; Vitelliform macular dystrophy protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
BEST1
Target Protein Sequence
MTITYTSQVANARLGSFSRLLLCWRGSIYKLLYGEFLIFLLCYYIIRFIYRLALTEEQQL MFEKLTLYCDSYIQLIPISFVLGFYVTLVVTRWWNQYENLPWPDRLMSLVSGFVEGKDEQ GRLLRRTLIRYANLGNVLILRSVSTAVYKRFPSAQHLVQAGFMTPAEHKQLEKLSLPHNM FWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVV TVAVYSFFLTCLVGRQFLNPAKAYPGHELDLVVPVFTFLQFFFYVGWLKVAEQLINPFGE DDDDFETNWIVDRNLQVSLLAVDEMHQDLPRMEPDMYWNKPEPQPPYTAASAQFRRASFM GSTFNISLNKEEMEFQPNQEDEEDAHAGIIGRFLGLQSHDHHPPRANSRTKLLWPKRESL LHEGLPKNHKAAKQNVRGQEDNKAWKLKAVDAFKSAPLYQRPGYYSAPQTPLSPTPMFFP LEPSAPSKLHSVTGIDTKDKSLKTVSSGAKKSFELLSESDGALMEHPEVSQVRRKTVEFN LTDMPEIPENHLKEPLEQSPTNIHTTLKDHMDPYWALENRDEAHS
Uniprot No.

Target Background

Function
Bestrophin-1 (BEST1) forms calcium-sensitive chloride channels. These channels exhibit high permeability to bicarbonate.
Gene References Into Functions
  1. hBest1's channel activity in human retinal pigment epithelium is significantly enhanced by adenosine triphosphate in a dose-dependent manner PMID: 30087350
  2. This study identified two recurrent genetic variations of BEST1 in two Chinese patients with either juvenile-onset BVMD or adult-onset BVMD. These findings expand the mutation spectrum of BEST1 and can be helpful for genetic counseling and prenatal diagnoses of patients with BVMD. PMID: 29115605
  3. These results highlight the critical role of BESTROPHIN1 in mediating the long-hypothesized Ca(2+)-dependent Cl(-) current in retinal pigment epithelium, which is the central disease-causing mechanism of BEST1 mutations. PMID: 29063836
  4. We identified a highly recognizable and reproducible retinal phenotype associated with a specific BEST1 mutation-p.Ala243Val in vitelliform macular dystrophy. PMID: 28225368
  5. We identified a consanguineous family with five affected individuals diagnosed with autosomal recessive bestrophinopathy and four confirmed carriers. Their pedigree indicated dominant inheritance with incomplete penetrance. PMID: 28481155
  6. Our research demonstrated that the two novel combinations of compound heterozygous mutations p.R141H/p.M325T and p.R141H/p.I201T in the BEST1 gene can also result in the autosomal recessive bestrophinopathy phenotype. PMID: 26333019
  7. The findings in this family emphasize the previously observed variability in clinical manifestations associated with BEST1-linked autosomal dominant vitreoretinochoroidopathy (ADVIRC) and the significance of FAF and NIA imaging. Cystoid macular edema and vascular leakage can be effectively managed using dorzolamide. PMID: 26771239
  8. Genetic analysis revealed single heterozygous BEST1 mutations in 13 patients and compound heterozygous mutations in 3 patients with Best vitelliform macular dystrophy. In patients with autosomal recessive bestrophinopathy, biallelic mutations were found in 13 probands and single mutant alleles in six patients. In total, 36 disease-causing variants (20 novel mutations) of the BEST1 gene were identified. PMID: 28687848
  9. Mutations in BEST1 exhibit variable penetrance and expressivity and can be uniocular. PMID: 27287821
  10. We identified 7 BEST1 variants, including 2 novel ones, in 9 Japanese patients diagnosed with autosomal recessive bestrophinopathy. PMID: 27163236
  11. Of the 225 genetic tests conducted, 150 were for recessive IRD, and 75 were for dominant IRD. A positive molecular diagnosis was established in 70 (59%) probands with recessive IRD and 19 (26%) probands with dominant IRD. We identified 32 novel variants; among them, 17 sequence changes in four genes (ABCA4, BEST1, PRPH2, and TIMP3) were predicted to be possibly or probably damaging. PMID: 28005406
  12. We describe the atypical phenotype and high intrafamilial variability associated with a new mutation in the BEST1 gene within an Italian family affected with Best vitelliform macular dystrophy. PMID: 26807628
  13. A clinical picture resembling autosomal recessive bestrophinopathy can also be caused by a single heterozygous mutation in the BEST1 gene, such as the c.614T>C (p.I205T) variant observed in this family. PMID: 26716959
  14. The secondary structure of Best1 and the influence of calcium have been characterized. PMID: 27768912
  15. BVMD can co-occur with other ocular disorders like ACG and FCE. We also identified 2 novel disease-causing mutations (p.Thr307Asp, p.Arg47His) in the BEST1 gene, one of which (p.Arg47His) has been reported in adult-onset vitelliform macular dystrophy (AVMD). PMID: 27078032
  16. Two previously unreported disease-associated variants in the BEST1 gene (p.Gly15Arg and p.Arg105Gly) were identified in Slovenian patients with Best disease. PMID: 27775230
  17. Nuclear spheres modulate the expression of BEST1 and GADD45G. PMID: 26521045
  18. Progressive posterior chorioretinal changes occurred over time in the initial ADVIRC proband, leading to visual loss. The causative mutation in this patient resides within the transmembrane domain of the BEST1 protein, with unclear functional consequences. PMID: 26849243
  19. HEK293T cells transfected with the identified BEST1 mutant exhibited significantly smaller currents compared to those transfected with the wild-type gene, while cells cotransfected with mutant and wild-type BEST1 showed good chloride conductance. PMID: 26720466
  20. Bestrophin 1 plays an essential role in volume regulation within human retinal pigment epithelium cells. PMID: 25941382
  21. We report a novel mutation within the BEST1 gene in the heterozygous form, leading to vitelliform lesions and secondary neovascularization that was successfully treated in a child with a course of bevacizumab. PMID: 25265375
  22. Dysfunction of bestrophin 1 can disrupt normal ion and fluid transport by the retinal pigment epithelium (RPE), interfering with, or even disrupting, direct interactions between the RPE and photoreceptors. PMID: 24328569
  23. We identified two novel BEST1 mutations and associated clinical observations in two unrelated patients with Best vitelliform macular dystrophy. PMID: 25936525
  24. Twelve distinct variants, including two novel ones (p.S7N and p.P346H), were identified in 13 Japanese families diagnosed with Best's vitelliform macular dystrophy. PMID: 26201355
  25. Genetic sequence analysis of BEST1 is crucial for diagnosing Best vitelliform dystrophy, especially in atypical cases, and contributes to our understanding of this disease. PMID: 26099059
  26. Best1 I366fsX18 differs from Best1 in that it lacks most of the cytosolic C-terminal domain, suggesting that the loss of this region contributes significantly to the pathogenesis of ARB in this patient. PMID: 26200502
  27. We describe three novel BEST1 mutations, highlighting that numerous deleterious variants in BEST1 leading to haploinsufficiency remain unidentified. PMID: 25545482
  28. BEST1 influences transepithelial electrical properties and Ca2+ signaling in human retinal pigment epithelium. PMID: 25878489
  29. The characteristics and combinations of different BEST1 mutations, as well as epistatic effects, can influence phenotype expression in Chinese patients with bestrophinopathy. PMID: 25489231
  30. We describe the clinical and genetic features of a young male diagnosed with autosomal recessive bestrophinopathy associated with angle-closure glaucoma resulting from a novel homozygous mutation in BEST1. PMID: 24859690
  31. Bestrophin-1 functions as an intracellular Cl channel that facilitates the accumulation and release of Ca(2+) from stores by conducting the counterion for Ca(2+). PMID: 24664688
  32. Our current and previous findings indicate that mislocalization of Best1 is not a universal feature of any individual bestrophinopathy. PMID: 24560797
  33. Results show that different mutations in Best1 exert differential effects on its localization, and this effect varies depending on the presence or absence of wild-type (WT) Best1. PMID: 23825107
  34. Best1V1 and Best1V1Deltaex2 formed Ca2+-activated Cl-channels, indicating that the N-terminus is not essential for channel function. Cells expressing Best1V2 lacked detectable Ca2+-activated Cl-currents, highlighting a crucial role for splicing of the C-terminus. PMID: 24341532
  35. Given relatively well-preserved retinal function, autosomal recessive bestrophinopathy may be a suitable initial candidate among BEST1-related ocular conditions for gene replacement therapy. PMID: 24345323
  36. Three basolateral sorting motifs may be involved in proper Best1 basolateral localization. PMID: 23880862
  37. In a large consanguineous family, the cosegregation of p.C251Y with a consistent ocular phenotype in all 5 patients strongly suggests traits associated with BEST1 homozygous mutations: ARB, angle-closure glaucoma, hyperopia, and cataracts. PMID: 23823511
  38. Case Reports: siblings with a missense mutation in BEST1 presenting with retinoschisis and best vitelliform macular dystrophy. PMID: 23572118
  39. Autosomal recessive bestrophinopathy is a distinct phenotype caused by autosomal recessively inherited mutations in the BEST1 gene. PMID: 23290749
  40. Ten variants in the BEST1 gene were detected in a group of Italian patients with clinically apparent vitelliform macular dystrophy. PMID: 23213274
  41. This case of unilateral vitelliform phenotype further supports the notion that autosomal recessive bestrophinopathy represents a disease spectrum in terms of severity, age at onset, and heritability. PMID: 22584882
  42. Our findings expand the mutation spectrum of BEST1 in patients with Best disease. Our frequency estimate confirms that Best disease is one of the most prevalent causes of early macular degeneration. PMID: 22633354
  43. Two siblings carrying a homozygous Arg141His mutation developed symptoms of typical Best vitelliform dystrophy, while their parents exhibited clinical features of mild maculopathy. PMID: 21809908
  44. Autosomal recessive Best vitelliform macular dystrophy can be caused by the compound heterozygous mutation L41P and I201T in the BEST1 gene. PMID: 22422030
  45. Molecular screening of the candidate genes BEST1 and PRPH2 did not reveal any mutations. PMID: 22174098
  46. We report, for the first time, a phenotype-genotype correlation in a Czech patient with Best disease. PMID: 22448417
  47. Biallelic BEST1 sequence variants can be associated with at least two distinct phenotypes: Best vitelliform macular dystrophy and autosomal recessive bestrophinopathy. PMID: 22162627
  48. BEST1 regulated cell function in the cytosol by modulating calcium signaling. PMID: 22183384
  49. Bestrophinopathies constitute a group of inherited retinal disorders primarily caused by point mutations scattered throughout the BEST1 gene. PMID: 22183385
  50. In truncating BEST1 mutations, the null phenotype associated with ARB is attributed to a substantial decrease in BEST1 expression mediated by the nonsense-mediated decay (NMD) surveillance mechanism. PMID: 22199244

Show More

Hide All

Database Links

HGNC: 12703

OMIM: 153700

KEGG: hsa:7439

STRING: 9606.ENSP00000399709

UniGene: Hs.524910

Involvement In Disease
Macular dystrophy, vitelliform, 2 (VMD2); Retinitis pigmentosa 50 (RP50); Bestrophinopathy, autosomal recessive (ARB); Vitreoretinochoroidopathy, autosomal dominant (ADVIRC)
Protein Families
Bestrophin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane.
Tissue Specificity
Predominantly expressed in the basolateral membrane of the retinal pigment epithelium.

Q&A

What is Recombinant Human Bestrophin-1 (BEST1) and what is its physiological role?

Recombinant Human Bestrophin-1 (BEST1) is a protein encoded by the BEST1 gene that functions primarily as a calcium-activated chloride channel (CaCC) in the retinal pigment epithelium (RPE). The BEST1 protein is predominantly expressed in RPE cells, where it plays an indispensable role in mediating Ca²⁺-dependent Cl⁻ currents . When BEST1 is stimulated by calcium ions, it opens to allow chloride ions to flow into and out of the cell, which is critical for maintaining proper ion homeostasis in RPE cells .

This ion transport function is essential for supporting photoreceptor health and maintaining the visual cycle. Physiologically, BEST1 contributes to the light peak (LP) response in electrooculography (EOG), which is a diagnostic measure of RPE function. Patients with BEST1 mutations typically exhibit reduced LP, which is considered a pathognomonic phenotype in bestrophinopathies .

How are BEST1 mutations classified and what diseases are associated with them?

BEST1 mutations are classified based on their inheritance pattern and clinical presentation. Over 200 distinct mutations in the BEST1 gene have been identified and associated with at least five distinct retinal degeneration disorders:

Disease TypeInheritance PatternClinical FeaturesCommon Mutation Types
Best vitelliform macular dystrophy (BVMD)Autosomal dominantCentral yellow "egg yolk" lesion in maculaMissense mutations
Autosomal recessive bestrophinopathy (ARB)Autosomal recessiveMultifocal subretinal deposits, RPE changesNull mutations (e.g., P274R)
Adult-onset vitelliform dystrophy (AVMD)Autosomal dominantLater onset, smaller vitelliform lesionsMissense mutations
Autosomal dominant vitreoretinochoroidopathy (ADVIRC)Autosomal dominantPeripheral retinal abnormalitiesSplice-site mutations
Retinitis pigmentosa (RP)Typically autosomal recessiveProgressive photoreceptor degenerationVarious types

These mutations can affect protein folding, localization, or function. For example, the P274R mutation completely abolishes Ca²⁺-dependent Cl⁻ current in RPE cells, while the I201T mutation causes only partial impairment of channel function, correlating with the severity of the clinical phenotype in patients .

What experimental models are currently used to study BEST1 function?

Several experimental models have been developed to study BEST1 function:

Model SystemApplicationsAdvantagesLimitations
Patient-derived iPSC-RPEDisease modeling, functional studiesPatient-specific mutations, physiologically relevantLabor-intensive, variability between lines
HEK293 cell expressionElectrophysiology, protein traffickingEase of manipulation, high expressionNon-native cellular environment
Bacterial bestrophin homologsStructural studies, basic channel propertiesEasier to purify and crystallizeEvolutionary divergence from human BEST1
Lipid bilayer systemsIsolated channel activityDirect measurement of channel functionLacks cellular regulatory mechanisms
Animal models (mouse, rat)In vivo disease modelingSystemic effects, retinal physiologySpecies differences in retinal structure

Patient-specific iPSC-based disease models have emerged as particularly valuable tools, as they allow researchers to directly correlate patient clinical phenotypes with electrophysiological properties in their RPEs and the structure-function relationships of BEST1 mutant channels .

How can we effectively measure and characterize Ca²⁺-dependent Cl⁻ currents mediated by BEST1?

Measurement of Ca²⁺-dependent Cl⁻ currents requires specialized electrophysiological techniques. The most direct and reliable method is whole-cell patch clamp recording, which can be performed on patient-derived iPSC-RPE cells or heterologous expression systems.

Methodological approach:

  • iPSC-RPE preparation: Generate iPSC-RPEs from patient or control fibroblasts using established reprogramming protocols

  • Patch clamp configuration: Utilize whole-cell patch clamp with carefully controlled intracellular Ca²⁺ concentrations

  • Data acquisition parameters:

    • Hold membrane potential at -50 to -80 mV

    • Step voltage protocol ranging from -100 to +100 mV

    • Internal solution containing varying free Ca²⁺ concentrations (0-1.2 μM)

    • External solution with physiological or modified Cl⁻ concentrations

The characteristic BEST1-mediated current shows outward rectification at positive potentials and is activated by intracellular Ca²⁺ in a concentration-dependent manner. Currents should be analyzed for peak amplitude, current-voltage relationships, and Ca²⁺ dose-response curves .

Alternative approaches include fluorescence-based chloride imaging with indicators such as MQAE or genetically encoded chloride sensors, which can provide spatial information about chloride flux across the RPE cell membrane.

What structural insights have been gained about BEST1 and how do they inform our understanding of mutation effects?

While the structure of human BEST1 has not been directly solved, significant structural insights have been obtained through bacterial homolog structures (KpBest and cBest1) and human homology models.

Key structural features of BEST1:

  • Pentameric assembly: BEST1 functions as a homopentamer with five identical subunits arranged around a central pore

  • Transmembrane domains: Each subunit contains multiple transmembrane helices forming the ion conduction pathway

  • Calcium binding sites: Specific residues coordinate Ca²⁺ binding to activate the channel

  • Neck region: Forms the narrowest part of the pore and is crucial for ion selectivity

Structural impact of mutations:
Different mutations can affect the structure and function of BEST1 in distinct ways:

Crystallographic studies with bacterial bestrophin homologs carrying equivalent mutations have provided direct evidence for these structural effects, complementing functional studies in patient-derived cells.

What approaches can be used to develop gene therapy strategies for BEST1-associated diseases?

Gene therapy represents a promising approach for treating BEST1-associated diseases, particularly for recessive forms like ARB. Research has demonstrated that viral expression of wild-type BEST1 can rescue the loss of Ca²⁺-dependent Cl⁻ current in patient-derived RPE cells carrying null mutations such as P274R .

Methodological considerations for BEST1 gene therapy:

  • Vector selection: AAV vectors (particularly serotypes with RPE tropism like AAV2/4, AAV2/5, or AAV2/8) are preferred due to their safety profile and efficient transduction of RPE cells

  • Construct design:

    • Promoter: RPE-specific promoters (e.g., RPE65, BEST1, or VMD2) ensure targeted expression

    • Coding sequence: Wild-type human BEST1 cDNA with codon optimization

    • Regulatory elements: Enhancers and polyadenylation signals for stable expression

  • Delivery route:

    • Subretinal injection targets RPE cells directly

    • Intravitreal delivery with enhanced viral vectors for better penetration

  • Efficacy assessment:

    • Functional rescue: Patch-clamp confirmation of restored Ca²⁺-dependent Cl⁻ currents

    • Morphological improvement: Reduction in vitelliform lesions or subretinal deposits

    • Visual function: Electroretinography (ERG), electrooculography (EOG), and visual acuity tests

For dominant mutations, alternative approaches such as allele-specific knockdown using RNA interference or CRISPR-based gene editing may be necessary to selectively suppress the mutant allele while preserving wild-type function .

How can iPSC-RPE disease models be optimized for BEST1 research?

  • Reprogramming and differentiation protocols:

    • Integration-free reprogramming methods (Sendai virus, episomal vectors)

    • Directed differentiation with defined factors (nicotinamide, Activin A, etc.)

    • Purification based on RPE-specific markers (MITF, RPE65, BEST1)

  • Validation of RPE identity and maturity:

    • Transcriptome analysis comparing to native RPE

    • Immunostaining for RPE markers (tight junctions, pigmentation)

    • Functional assays (phagocytosis, barrier function, transepithelial resistance)

    • BEST1 expression and proper membrane localization

  • Disease phenotype characterization:

    • Electrophysiological assessment of Ca²⁺-dependent Cl⁻ currents

    • Ultrastructural analysis of RPE morphology

    • Fluid and ion transport assays

    • Response to pharmacological modulators

  • Experimental controls:

    • Isogenic controls generated by CRISPR correction of mutations

    • Multiple independent iPSC lines from the same patient

    • RPE cells from age-matched healthy donors

The "disease-in-a-dish" approach with iPSC-RPEs enables prediction of the pathological potential of various BEST1 mutations and provides a platform for testing therapeutic interventions before clinical application .

What are the challenges in distinguishing phenotypes of dominant versus recessive BEST1 mutations?

Analyzing the functional and structural consequences of dominant versus recessive BEST1 mutations presents unique challenges:

ChallengeDominant MutationsRecessive MutationsMethodological Approach
Protein compositionHeterogeneous pentamers with mixed WT/mutant subunitsHomogeneous pentamers with all mutant subunitsControlled expression systems with tagged WT/mutant proteins
Stoichiometry effectsVariable effects based on number of mutant subunitsAll-or-none effectsSingle-molecule imaging or biochemical quantification of subunit ratio
Rescue strategiesMay require mutant suppression plus WT supplementationOnly require WT supplementationAllele-specific targeting versus conventional gene supplementation
Structural analysisDifficult to interpret due to heteropentamersCleaner interpretation with homopentamersIn vitro reconstitution with defined subunit composition

As noted in the literature, recessive BEST1 mutations from ARB patients provide a "cleaner" system for analysis since only the mutant BEST1 proteins are present. In contrast, dominant mutations present the complexities of co-existing wild-type and mutant proteins, with pentameric channels potentially containing various combinations of wild-type and mutant protomers .

This heterogeneity makes it difficult to determine the precise ratio of wild-type to mutant proteins in patient cells and complicates interpretation of structural studies, which typically examine homopentamers rather than the heteropentamers likely present in patients with dominant mutations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.