Recombinant Human Bestrophin-4 (BEST4)

Shipped with Ice Packs
In Stock

Description

Introduction to Bestrophin-4

Bestrophin-4 (BEST4), also known as VMD2L2 (Vitelliform Macular Dystrophy 2-Like 2), represents a newly identified subtype of the calcium-activated chloride channel family. It belongs to the bestrophin protein family, which consists of four members (BEST1-4) in humans . While other bestrophin family members have been extensively studied in various contexts, BEST4 has only recently gained attention due to its specialized expression pattern and potential roles in disease.

Single-cell RNA-sequencing analysis has revealed that BEST4 is expressed in a specific cluster of mature colonocytes in humans, suggesting a specialized physiological role in intestinal epithelial function . This distinct expression pattern differentiates BEST4 from other family members and indicates potential tissue-specific functions that warrant further investigation.

The bestrophin family proteins function primarily as calcium-activated chloride channels, but emerging evidence suggests they may possess additional non-canonical functions, particularly in the context of cancer biology. Understanding the full spectrum of BEST4's biological activities remains an active area of research with significant implications for both physiological processes and disease mechanisms.

Physiological Functions of BEST4

In the human colon, the presence of BEST4 in a distinct population of mature colonocytes suggests a specialized role in colonic epithelial function . This restricted expression pattern implies that BEST4 may serve specific functions that are not redundant with other chloride channels or bestrophin family members, potentially related to ion transport and fluid homeostasis in the large intestine.

Recent research has also identified BEST4 in the nucleus of cells, co-localized with transcription factors such as HES4 . This nuclear localization suggests potential roles beyond membrane ion transport, possibly including involvement in transcriptional regulation or nuclear signaling pathways. The dual localization of BEST4 at both the membrane and nucleus indicates a multifunctional nature that could explain its diverse effects in normal and pathological states.

Further studies are needed to fully characterize the physiological functions of BEST4 in the intestinal epithelium and other tissues where it may be expressed. Understanding these normal functions will provide important context for interpreting BEST4's roles in disease states, particularly in colorectal cancer where conflicting evidence has emerged regarding its contributions to pathogenesis.

BEST4 in Colorectal Cancer: Tumor Suppressor Evidence

Compelling evidence from recent studies suggests that BEST4 may function as a tumor suppressor in colorectal cancer (CRC). In vitro experiments have demonstrated that overexpression of BEST4 in CRC cell lines such as HCT116 and Caco2 significantly reduces cell proliferation rates by approximately 50% compared to control cells . This anti-proliferative effect is accompanied by decreased cell viability and reduced colony formation capacity, with BEST4 overexpression decreasing colony formations by 60-70% in these cell lines .

The tumor-suppressive effect of BEST4 is further supported by loss-of-function experiments. Knockout of BEST4 using CRISPR/Cas9 in the HCT-15 cell line resulted in a 50% increase in proliferation rates and a fivefold increase in colony formation compared to parental controls . Importantly, these effects were reversible when BEST4 expression was rescued, confirming the specific role of BEST4 in suppressing tumor cell growth .

BEST4 also appears to inhibit cell migration and invasion, key processes in cancer metastasis. Overexpression of BEST4 in HCT116 inhibited transwell migration and invasion by 70% and 80%, respectively . Conversely, BEST4 ablation in HCT-15 increased cell migration and invasion by two- and three-fold, respectively, effects that were reversed upon BEST4 re-expression .

Table 2: Effects of BEST4 Modulation on CRC Cell Properties

Cell LineBEST4 StatusEffect on ProliferationEffect on Colony FormationEffect on MigrationEffect on Invasion
HCT116Overexpressed50% decrease60% decrease70% decrease80% decrease
Caco2Overexpressed50% decrease70% decreaseNot reportedNot reported
HCT-15Knocked out50% increase500% increase200% increase300% increase
HCT-15RescuedReversal of knockout effectsReversal of knockout effectsReversal of knockout effectsReversal of knockout effects

The tumor-suppressive functions of BEST4 have also been demonstrated in vivo. In xenograft models using BALB/c nude mice, tumors derived from BEST4-overexpressing HCT116 cells showed reduced growth compared to controls . Moreover, in a model of CRC liver metastasis, HCT-15 cells with BEST4 knockout produced twice as many liver metastatic nodules as control cells, while cells with rescued BEST4 expression showed no detectable metastatic nodules in the liver .

Clinically, low levels of BEST4 mRNA have been correlated with advanced disease stage and worse prognosis in CRC patients, further supporting its role as a tumor suppressor . These findings collectively suggest that BEST4 may have significant value as both a prognostic marker and potential therapeutic target in colorectal cancer.

BEST4 in Colorectal Cancer: Oncogenic Potential

In contrast to the tumor-suppressive role described above, other research suggests that BEST4 may have oncogenic potential in CRC. A study by Chen et al. reported that BEST4 expression is upregulated in clinical CRC samples, and its high-level expression correlates with advanced TNM (tumor, lymph nodes, distant metastasis) stage, lymph node metastasis (LNM), and poor survival .

Functional studies from this research showed that ectopic expression of BEST4 promoted CRC cell proliferation and metastasis, while depletion of BEST4 inhibited these processes both in vitro and in vivo . These findings directly contradict the tumor-suppressive effects described in other studies, highlighting the complex and potentially context-dependent role of BEST4 in cancer biology.

Mechanistically, this study proposed that BEST4 exerts oncogenic effects by binding to the p85α regulatory subunit of phosphatidylinositol-3-kinase (PI3K), promoting p110 kinase activity and thereby activating Akt signaling . This activation leads to increased expression of MYC and CCND1, critical regulators of cell proliferation and metastasis . In clinical samples, BEST4 expression was positively associated with phosphorylated Akt, MYC, and CCND1 expression .

Interestingly, the interaction between BEST4 and p85α was enhanced by epidermal growth factor (EGF) in CRC cells, suggesting a link between BEST4 and growth factor signaling . From a therapeutic perspective, BEST4 suppression was found to effectively sensitize CRC cells to gefitinib treatment in vivo, pointing to potential applications in combination therapy approaches .

Table 3: Conflicting Findings on BEST4's Role in CRC

StudyReported RoleKey FindingsProposed Mechanism
Wang et al. (2023/2024) Tumor SuppressorBEST4 overexpression reduces proliferation, colony formation, migration, and invasionInhibition of EMT via downregulation of TWIST1
Chen et al. (2021) OncogeneBEST4 overexpression promotes proliferation and metastasisActivation of PI3K/Akt signaling pathway

These contradictory findings highlight the complexity of cancer biology and underscore the need for further research to clarify the context-specific roles of BEST4 in colorectal cancer. Factors such as genetic background, tumor microenvironment, or disease stage might influence whether BEST4 functions as a tumor suppressor or oncogene in specific settings.

Molecular Mechanisms of BEST4 Action

Recent research has begun to elucidate the molecular mechanisms underlying BEST4's functions in CRC cells. A significant finding is the interplay between BEST4 and the transcription factor HES4 (hairy/enhancer of split 4). BEST4 is co-expressed with HES4 in the nucleus of cells, and HES4 appears to regulate BEST4 expression by interacting with the upstream region of the BEST4 promoter .

Chromatin immunoprecipitation (ChIP) analysis revealed a twelve-fold enrichment of HES4 binding to the P3 region upstream of the BEST4 transcriptional start site . Overexpression of HES4 in HCT116 cells upregulated endogenous BEST4 at both mRNA and protein levels, while knockdown of HES4 in LS174T cells downregulated BEST4 expression . Interestingly, BEST4 overexpression did not affect HES4 expression, suggesting that HES4 acts upstream of BEST4 in this regulatory pathway .

BEST4 appears to be epistatic to HES4 and exerts its tumor-suppressive effects by downregulating TWIST1, a key transcription factor involved in epithelial-to-mesenchymal transition (EMT) . When HES4 was knocked down in BEST4-overexpressing HCT116 cells, there was corresponding downregulation of epithelial markers (E-cadherin and ZO-1) and upregulation of mesenchymal markers (TWIST1 and vimentin) . Conversely, BEST4 overexpression in LS174T cells had the opposite effect .

Mechanistically, BEST4 suppresses EMT by upregulating epithelial markers such as E-cadherin (CDH1) and tight junction protein 1 (TJP1), while downregulating mesenchymal markers including vimentin (VIM) and TWIST1 . These changes were confirmed at both mRNA and protein levels and were reversed in BEST4 knockout cells .

Importantly, studies have investigated whether BEST4's effects on EMT were dependent on its channel function. Treatment with chloride channel inhibitors (DIDS or CaCCinh-A01) or calcium ionophore (ionomycin) did not alter the expression of EMT markers in BEST4-overexpressing cells . This suggests that BEST4's role in suppressing EMT is independent of its channel function, pointing to non-canonical roles for this protein that extend beyond its classification as an ion channel.

Clinical Implications and Potential Applications

The contradictory findings regarding BEST4's role in CRC have important clinical implications. If BEST4 indeed functions as a tumor suppressor, its expression levels might serve as a prognostic marker, with lower levels predicting more aggressive disease and worse outcomes . Conversely, if BEST4 has oncogenic potential, high expression might indicate poor prognosis and potentially identify patients who could benefit from therapies targeting PI3K/Akt signaling .

From a therapeutic perspective, recombinant BEST4 protein could potentially be utilized in various applications. If its tumor-suppressive functions are confirmed, strategies to enhance BEST4 expression or activity might represent a novel approach to CRC treatment. Alternatively, if its oncogenic potential is validated, inhibitors of BEST4 or its downstream pathways could be developed as therapeutic agents.

The association between BEST4 and response to targeted therapies is particularly intriguing. The finding that BEST4 suppression sensitizes CRC cells to gefitinib treatment suggests potential applications in combination therapy approaches . This interaction between BEST4 and EGFR inhibition could be exploited to improve outcomes in patients with colorectal cancer.

Further research is needed to reconcile the conflicting evidence regarding BEST4's role in CRC and to determine the factors that influence its function in different contexts. Understanding these nuances could potentially lead to more personalized approaches to CRC diagnosis and treatment, with BEST4 status serving as a biomarker for disease stratification and therapeutic decision-making.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
BEST4; VMD2L2; Bestrophin-4; Vitelliform macular dystrophy 2-like protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-473
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
BEST4
Target Protein Sequence
MTVSYTLKVAEARFGGFSGLLLRWRGSIYKLLYKEFLLFGALYAVLSITYRLLLTQEQRY VYAQVARYCNRSADLIPLSFVLGFYVTLVVNRWWSQYTSIPLPDQLMCVISASVHGVDQR GRLLRRTLIRYANLASVLVLRSVSTRVLKRFPTMEHVVDAGFMSQEERKKFESLKSDFNK YWVPCVWFTNLAAQARRDGRIRDDIALCLLLEELNKYRAKCSMLFHYDWISIPLVYTQVV TIAVYSFFALSLVGRQFVEPEAGAAKPQKLLKPGQEPAPALGDPDMYVPLTTLLQFFFYA GWLKVAEQIINPFGEDDDDFETNQLIDRNLQVSLLSVDEMYQNLPPAEKDQYWDEDQPQP PYTVATAAESLRPSFLGSTFNLRMSDDPEQSLQVEASPGSGRPAPAAQTPLLGRFLGVGA PSPAISLRNFGRVRGTPRPPHLLRFRAEEGGDPEAAARIEEESAESGDEALEP
Uniprot No.

Target Background

Function
Bestrophin-4 (BEST4) forms calcium-sensitive chloride channels. It is permeable to bicarbonate.
Gene References Into Functions
  1. BEST2 and BEST4 were found to be among the lineage-specific genes expressed in human intestinal epithelial cells. PMID: 24223998
  2. Three novel VMD2-related human genes were identified, exhibiting high conservation in their respective RFP-TM domains. PMID: 12032738
  3. Human Best4 chloride channels, when studied on excised membrane patches, were found to be activated by free calcium (Ca2+) on the cytoplasmic side. PMID: 16702355
  4. Research suggests that bestrophins are expressed in pancreatic duct cells, with hBest1 playing a role in the calcium-activated chloride channels found in these cells. PMID: 19237432
Database Links

HGNC: 17106

OMIM: 607336

KEGG: hsa:266675

STRING: 9606.ENSP00000361281

UniGene: Hs.302513

Protein Families
Bestrophin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly found in colon and the weakly in fetal brain, spinal cord, retina, lung, trachea, testis and placenta.

Q&A

What is Human Bestrophin-4 (BEST4) and what is its primary biological function?

Bestrophin-4 (BEST4) is a newly identified subtype of the calcium-activated chloride channel family. Single-cell RNA-sequencing analysis has revealed the existence of a distinct cluster of BEST4+ mature colonocytes in the human colon . While its ion channel function has been established, recent research has uncovered its significant role in cancer biology, particularly in colorectal cancer (CRC).

BEST4 functions as a tumor suppressor by inhibiting cell proliferation, migration, invasion, and colony formation in colorectal cancer cells . Moreover, it plays a crucial role in preventing epithelial-to-mesenchymal transition (EMT), a critical process in tumor progression and metastasis . This tumor-suppressive function is mediated through its interaction with other regulatory proteins, particularly HES4 and TWIST1, forming a regulatory network that controls cancer cell behavior.

How is BEST4 expression regulated in normal versus cancerous tissues?

BEST4 expression exhibits significant differences between normal and cancerous tissues. High-throughput whole transcriptome sequencing analysis of colorectal cancers and adjacent normal tissues has identified BEST4 among the top four significantly downregulated genes in CRC compared to normal tissues .

Quantitative PCR validation in paired tissues of 50 colorectal adenomas and 124 CRCs has confirmed that BEST4 expression is significantly reduced in both adenomas and tumors compared to adjacent normal tissues . This progressive loss of expression from normal tissue to adenoma to carcinoma suggests BEST4 downregulation may be an early event in colorectal carcinogenesis.

Furthermore, immunoblotting analyses of tissue lysates have shown that BEST4 protein levels are consistently lower in CRC samples compared to matched normal tissues . This decreased expression in cancerous tissues aligns with BEST4's tumor-suppressive function, suggesting that loss of BEST4 may contribute to cancer development and progression.

What molecular pathways does BEST4 influence in cancer progression?

BEST4 significantly influences several molecular pathways critical to cancer progression:

  • Epithelial-to-Mesenchymal Transition (EMT) Pathway: BEST4 plays a central role in regulating EMT, a process crucial for cancer invasion and metastasis. Experimental evidence shows that BEST4 expression upregulates epithelial markers such as CDH1 (E-cadherin) and TJP1 (tight junction protein 1), while downregulating mesenchymal markers including VIM (vimentin) and TWIST1 . These changes help maintain epithelial characteristics and suppress cancer cell invasion.

  • HES4-BEST4-TWIST1 Regulatory Axis: BEST4 functions within a regulatory pathway involving HES4 and TWIST1. HES4 signals BEST4 by interacting with the upstream region of the BEST4 promoter, and BEST4 subsequently downregulates TWIST1, a key transcription factor promoting EMT . This regulatory cascade demonstrates how BEST4 connects transcriptional regulation to phenotypic outcomes in cancer cells.

  • Cell Proliferation and Survival Pathways: BEST4 overexpression attenuates cell proliferation rates by approximately 50% and decreases cell viability in colorectal cancer cell lines . Conversely, BEST4 knockout increases proliferation and viability, indicating that BEST4 negatively regulates pathways controlling cell division and survival.

These molecular interactions collectively explain how BEST4 functions as a tumor suppressor in colorectal cancer, with its downregulation potentially contributing to cancer development and progression.

How does BEST4 inhibit epithelial-to-mesenchymal transition in colorectal cancer?

BEST4 inhibits epithelial-to-mesenchymal transition (EMT) in colorectal cancer through a complex molecular mechanism involving multiple regulatory pathways:

  • Regulation of EMT Markers: Quantitative PCR and western blotting analyses have demonstrated that BEST4 expression significantly upregulates epithelial markers CDH1 (E-cadherin) and TJP1 (tight junction protein 1), while simultaneously downregulating mesenchymal markers VIM (vimentin) and TWIST1 . This reciprocal regulation helps maintain the epithelial phenotype and prevents the acquisition of mesenchymal characteristics.

  • TWIST1 Suppression: BEST4 specifically downregulates TWIST1, a master transcription factor that drives EMT . By suppressing TWIST1 expression, BEST4 prevents the activation of downstream mesenchymal programs that would otherwise promote invasion and metastasis.

  • Integration with HES4 Signaling: BEST4 is co-expressed and functionally connected with HES4 in the nucleus of cells . Research has shown that HES4 regulates BEST4 expression by binding to the BEST4 promoter region, and BEST4 is epistatic to HES4 in this regulatory pathway . This HES4-BEST4 axis forms part of the molecular mechanism by which BEST4 controls EMT.

  • Functional Consequences: The inhibition of EMT by BEST4 has direct functional consequences on cancer cell behavior. BEST4 overexpression inhibits transwell migration and invasion by 70% and 80%, respectively, in colorectal cancer cells . Conversely, BEST4 deletion increases cell migration and invasion by twofold and threefold, respectively, effects that are reversible when BEST4 expression is rescued.

These molecular mechanisms collectively explain how BEST4 functions as a suppressor of EMT and, consequently, as an inhibitor of colorectal cancer progression and metastasis.

What is the mechanism of interaction between BEST4 and HES4 in gene regulation?

The interaction between BEST4 and HES4 represents a sophisticated regulatory mechanism that affects gene expression in cancer cells:

  • Transcriptional Regulation: HES4 functions as an upstream regulator of BEST4 expression. Upon transfection of Flag-HES4 plasmid DNA into the HCT116 colorectal cancer cell line, researchers observed significant upregulation of both endogenous BEST4 mRNA and protein levels compared to control cells . This regulatory relationship was further confirmed by knocking down endogenous HES4 with short hairpin RNAs in the LS174T cell line, which resulted in downregulation of endogenous BEST4 .

  • Direct Promoter Binding: Dual-luciferase reporter assays have demonstrated a fourfold increase in BEST4 promoter activity in HES4-expressing HCT116 cells compared to empty vector controls . More specifically, chromatin immunoprecipitation-quantitative PCR (ChIP-qPCR) analysis revealed a 12-fold enrichment of the P3 region upstream of the BEST4 transcriptional start site when HES4 was immunoprecipitated . This finding indicates that HES4 directly binds to the BEST4 promoter to enhance its transcription.

  • Nuclear Co-localization: Immunofluorescence staining has documented the co-localization of BEST4 and HES4 in the nucleus of HCT116 cells . This spatial proximity suggests potential functional interactions beyond transcriptional regulation.

  • Physical Interaction: Co-immunoprecipitation of nuclear extracts has confirmed the physical interaction between specifically tagged BEST4 and HES4 proteins . This direct protein-protein interaction may contribute to their functional cooperation in regulating gene expression.

  • Unidirectional Regulation: Interestingly, while HES4 regulates BEST4 expression, BEST4 overexpression does not affect HES4 mRNA levels . This unidirectional regulatory relationship positions HES4 firmly upstream of BEST4 in this signaling pathway.

This HES4-BEST4 regulatory axis represents a novel mechanism through which gene expression is controlled in colorectal cancer cells, with significant implications for understanding tumor suppression and potential therapeutic interventions.

What are the prognostic implications of BEST4 expression in colorectal cancer patients?

The expression level of BEST4 has significant prognostic implications for colorectal cancer patients:

  • Correlation with Disease Progression: Low levels of BEST4 mRNA have been correlated with advanced colorectal cancer and worse prognosis . This finding suggests that BEST4 expression may serve as a biomarker for disease progression and patient outcomes.

  • Expression Pattern in the Adenoma-Carcinoma Sequence: High-throughput whole transcriptome sequencing analysis has identified BEST4 among the top four significantly downregulated genes in colorectal cancer compared to adjacent normal tissues . Further validation by quantitative PCR in paired tissues of 50 colorectal adenomas and 124 CRCs has confirmed significantly lower BEST4 expression in both adenomas and tumors compared to normal tissues . This progressive loss of expression throughout the adenoma-carcinoma sequence suggests BEST4 downregulation may be an early event in colorectal carcinogenesis.

  • Mechanistic Basis for Prognostic Value: The prognostic significance of BEST4 is mechanistically supported by experimental evidence showing that BEST4 overexpression impedes tumor growth and liver metastasis in vivo . Conversely, BEST4 knockout using CRISPR/Cas9 in CRC cells revitalizes tumor growth and induces epithelial-to-mesenchymal transition , a process associated with increased invasiveness and metastatic potential.

  • Potential as a Biomarker: Given the consistent downregulation of BEST4 in colorectal cancer and its correlation with disease progression, BEST4 expression levels could potentially serve as a prognostic biomarker. Lower expression may indicate more aggressive disease and poorer outcomes, providing valuable information for clinical decision-making.

These findings highlight the clinical relevance of BEST4 beyond its biological role in cancer progression, suggesting its potential utility in patient stratification and personalized treatment approaches.

What experimental approaches are most effective for studying BEST4 function in cancer research?

Several experimental approaches have proven effective for studying BEST4 function in cancer research:

  • Gene Expression Modulation:

    • Overexpression Studies: Constructing BEST4-expressing cancer cell lines (such as HCT116 and Caco2) has demonstrated that BEST4 overexpression halves cell proliferation rates and decreases viability compared to controls .

    • CRISPR/Cas9 Knockout: Targeted deletion of BEST4 using CRISPR/Cas9 in HCT-15 cells has revealed a 50% increase in proliferation rates and viability, confirming BEST4's tumor-suppressive role .

    • Rescue Experiments: Reintroducing BEST4 expression in knockout models has proven crucial for confirming phenotype specificity, as rescued expression reverses the effects of BEST4 deletion .

  • Functional Assays:

    • Proliferation and Viability Assays: Live-cell monitoring using systems like IncuCyte provides dynamic, real-time measurement of cell proliferation under different BEST4 expression conditions .

    • Colony Formation Assays: These have shown that BEST4 overexpression decreases colony formations by 60-70% in colorectal cancer cells .

    • Transwell Migration and Invasion Assays: These demonstrate that BEST4 overexpression inhibits cell migration and invasion by 70% and 80%, respectively .

  • Molecular Analyses:

    • Quantitative PCR: Essential for measuring changes in BEST4 and EMT-related gene expression (CDH1, TJP1, VIM, TWIST1) .

    • Immunoblotting: Critical for confirming corresponding protein-level changes and validating gene expression results .

    • ChIP-qPCR: Reveals protein interactions with the BEST4 promoter, such as the 12-fold enrichment of HES4 binding to the P3 region of the BEST4 promoter .

  • In Vivo Models:

    • Xenograft Tumor Models: These have confirmed BEST4's role in suppressing tumor growth in mice .

    • Liver Metastasis Models: Intrasplenic injection models have demonstrated that BEST4 knockout results in twofold greater liver metastatic nodules, while BEST4 rescue prevents metastasis .

  • Protein Interaction Studies:

    • Co-immunoprecipitation: Detects physical interactions between proteins such as BEST4 and HES4 .

    • Immunofluorescence Co-localization: Documents the subcellular localization and co-expression of proteins like BEST4 and HES4 in the nucleus .

  • Promoter Analysis:

    • Dual-Luciferase Reporter Assays: These assess BEST4 promoter activity, showing a fourfold increase in HES4-expressing cells .

These complementary approaches provide a comprehensive understanding of BEST4's functions and mechanisms in cancer biology, from molecular interactions to in vivo tumor suppression.

What are the key considerations when designing CRISPR/Cas9 knockout experiments for BEST4?

When designing CRISPR/Cas9 knockout experiments for BEST4, researchers should consider several critical factors to ensure experimental validity and meaningful results:

  • Guide RNA (gRNA) Design:

    • Target Specificity: Design gRNAs that specifically target BEST4 while minimizing off-target effects. In published BEST4 research, successful CRISPR/Cas9 knockout was achieved in HCT-15 cells, indicating viable target sequences exist within the BEST4 gene .

    • Target Location: Target early exons or critical functional domains to ensure complete loss of protein function rather than truncated but potentially functional variants.

    • Efficiency Prediction: Utilize bioinformatic tools to predict gRNA efficiency and potential off-target sites before experimental implementation.

  • Validation of Knockout Efficiency:

    • Multiple Validation Methods: Confirm BEST4 knockout at both mRNA and protein levels using quantitative PCR and immunoblotting, as demonstrated in successful BEST4 knockout studies .

    • Clonal Selection: Generate and characterize multiple independent knockout clones to account for potential clonal variation and confirm consistent phenotypes.

  • Essential Controls:

    • Non-targeting Controls: Include cells transfected with non-targeting gRNAs that undergo the same selection processes as the knockout cells.

    • Parental Cell Line: Maintain the unmodified parental cell line as a reference control, as used in published BEST4 knockout studies .

    • Rescue Controls: Generate rescue cell lines by reintroducing BEST4 expression in knockout cells to demonstrate phenotype specificity. This approach was critical in demonstrating that the effects of BEST4 knockout could be reversed in HCT-15 cells .

  • Cell Line Selection:

    • Endogenous Expression Level: Choose cell lines with detectable baseline BEST4 expression to ensure observable effects upon knockout. HCT-15 was successfully used for BEST4 knockout in published research .

    • Functional Context: Consider the expression of interacting partners like HES4 when selecting cell lines to maintain the relevant biological context.

  • Comprehensive Phenotypic Analysis:

    • Proliferation and Viability: Assess changes in cell proliferation rates and viability, which showed a 50% increase following BEST4 knockout in HCT-15 cells .

    • Colony Formation: Evaluate colony-forming ability, which increased fivefold in BEST4-deleted HCT-15 cells .

    • Migration and Invasion: Measure changes in cell migration and invasion, which increased by twofold and threefold respectively in BEST4 knockout cells .

    • EMT Marker Expression: Analyze changes in epithelial and mesenchymal markers, as BEST4 knockout was shown to downregulate CDH1 and TJP1 while upregulating VIM and TWIST1 .

  • In Vivo Validation:

    • Tumor Growth Models: Consider xenograft models to assess how BEST4 knockout affects tumor formation and growth in vivo.

    • Metastasis Models: Evaluate metastatic potential using appropriate models, such as the intrasplenic injection model that demonstrated increased liver metastasis in BEST4 knockout cells .

By addressing these considerations, researchers can design robust CRISPR/Cas9 knockout experiments that provide valid and meaningful insights into BEST4 function in cancer biology.

How can researchers accurately detect and quantify BEST4 expression in different sample types?

Accurate detection and quantification of BEST4 expression across different sample types requires selecting appropriate methods based on the specific research question and sample characteristics:

  • mRNA Expression Analysis:

    • Quantitative Real-Time PCR (qPCR): Successfully used in multiple BEST4 studies to quantify mRNA expression in cell lines and tissue samples . This method requires:

      • Careful primer design specific to BEST4

      • Appropriate reference gene selection for normalization

      • High-quality RNA extraction protocols

    • RNA-Sequencing (RNA-Seq): Employed to identify BEST4 as one of the top downregulated genes in colorectal cancer compared to adjacent normal tissues . This approach provides:

      • Comprehensive transcriptome profiles

      • Discovery of novel splice variants

      • Correlation of BEST4 with broader expression patterns

    • Single-Cell RNA-Sequencing: Used to identify BEST4+ colonocytes as a distinct cell population in human colonic epithelium . This method is valuable for:

      • Studying BEST4 expression heterogeneity at the cellular level

      • Identifying specific cell populations expressing BEST4

      • Understanding cell-type specific expression patterns

  • Protein Expression Analysis:

    • Western Blotting/Immunoblotting: Effectively used in BEST4 studies for protein detection in cell lines and tissue samples . This approach:

      • Provides information about protein size and potential isoforms

      • Requires validated antibodies specific to BEST4

      • Allows semi-quantitative comparison between samples

    • Immunofluorescence: Successfully employed to study BEST4 cellular localization and co-localization with other proteins like HES4 . This technique:

      • Provides subcellular localization information

      • Enables multi-color staining to investigate protein interactions

      • Offers higher resolution compared to other methods

    • ELISA (Enzyme-Linked Immunosorbent Assay): Human Bestrophin-4(BEST4) ELISA kits are available with high specificity and low cross-reactivity . These kits:

      • Provide quantitative measurement of BEST4 protein concentration

      • Show standard deviation less than 8% for repeated standards

      • Maintain less than 10% variation when the same sample is measured by different operators

  • Sample-Specific Considerations:

    • Cell Lines: All methods are generally applicable. Creating stable BEST4-expressing cell lines or CRISPR knockout lines provides valuable positive and negative controls .

    • Tissue Samples: For clinical samples, consider:

      • RNA quality and degradation in stored samples

      • Standardization of collection and processing protocols

      • Using multiple detection methods for cross-validation

    • Paired Normal-Tumor Samples: When available, paired samples provide the most reliable comparison for BEST4 expression changes, as demonstrated in studies analyzing BEST4 expression in colorectal cancers and adjacent normal tissues .

By selecting the appropriate methods based on sample type and research question, researchers can accurately detect and quantify BEST4 expression across various experimental and clinical contexts.

Effects of BEST4 Manipulation on Colorectal Cancer Cell Phenotypes

Experimental ApproachCell LineEffect on ProliferationEffect on Colony FormationEffect on MigrationEffect on Invasion
BEST4 OverexpressionHCT11650% decrease60% decrease70% decrease80% decrease
BEST4 OverexpressionCaco250% decrease70% decreaseNot reportedNot reported
BEST4 Knockout (CRISPR/Cas9)HCT-1550% increase5-fold increase2-fold increase3-fold increase
BEST4 Rescue in KnockoutHCT-15Reversal to normal levelsCounteracted enhancementReversal to normal levelsReversal to normal levels

This table summarizes the functional effects of BEST4 manipulation in colorectal cancer cell lines, demonstrating its consistent tumor-suppressive role across multiple experimental approaches and cellular phenotypes .

Impact of BEST4 on EMT-Related Gene and Protein Expression

Gene/ProteinEffect of BEST4 OverexpressionEffect of BEST4 KnockoutEffect of BEST4 Rescue in Knockout
CDH1 (E-cadherin)UpregulationDownregulationReversal to normal levels
TJP1 (Tight junction protein 1)UpregulationDownregulationReversal to normal levels
VIM (Vimentin)DownregulationUpregulationReversal to normal levels
TWIST1DownregulationUpregulationReversal to normal levels

This table illustrates BEST4's role in regulating epithelial-to-mesenchymal transition markers, showing its consistent effect in maintaining epithelial characteristics (CDH1, TJP1) while suppressing mesenchymal features (VIM, TWIST1) .

Regulatory Relationship Between HES4 and BEST4

Experimental ApproachCell LineEffect on BEST4 ExpressionMechanism
HES4 OverexpressionHCT116Upregulation of BEST4 mRNA and proteinDirect binding to BEST4 promoter (12-fold enrichment at P3 region)
HES4 Knockdown (shRNA)LS174TDownregulation of BEST4 mRNA and proteinReduced transcriptional activation
BEST4 OverexpressionHCT116No effect on HES4 mRNA levelsNot applicable

This table summarizes the unidirectional regulatory relationship between HES4 and BEST4, where HES4 functions as an upstream regulator of BEST4 expression through direct promoter binding .

BEST4 Expression in Clinical Samples

Sample TypeBEST4 Expression LevelValidation Method
Normal Colonic TissueHigh (reference)qPCR, Immunoblotting, RNA-seq
Colorectal AdenomasSignificantly lower than normalqPCR
Colorectal CancerSignificantly lower than normalqPCR, Immunoblotting, RNA-seq
CRC with Advanced StageCorrelated with lower BEST4 levelsClinical correlation analysis
CRC with Poor PrognosisCorrelated with lower BEST4 levelsClinical correlation analysis

This table illustrates the progressive loss of BEST4 expression from normal tissue to adenoma to carcinoma, highlighting its potential role in the adenoma-carcinoma sequence and its correlation with disease progression and prognosis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.