Recombinant Human BET1 homolog (BET1)

Shipped with Ice Packs
In Stock

Description

Functional Role in Vesicular Transport

BET1 functions as a soluble NSF attachment protein receptor (SNARE) essential for docking ER-derived vesicles to the cis-Golgi membrane . Key mechanistic insights include:

  • Pre-Golgi Intermediate Compartment Localization: Immunofluorescence studies show BET1 enrichment in vesicular-tubular clusters near the Golgi, colocalizing with markers like ERGIC-53 and KDEL receptor .

  • Transport Inhibition: Antibodies against BET1 block ER-to-Golgi transport in vitro, specifically at the vesicle docking stage .

  • Disease Links: Reduced BET1 activity correlates with neonatal intrahepatic cholestasis and citrullinemia due to disrupted protein trafficking .

Research Applications

Recombinant BET1 is widely used in:

  • Antibody Development: Serves as an immunogen for polyclonal antibodies validated in Western blot (WB) and ELISA .

  • Transport Assays: Critical for reconstituting ER-Golgi trafficking in cell-free systems .

  • Phosphoproteomics: Phosphorylation at Ser50 modulates BET1 function in cancer models, with altered levels observed in colorectal cancer cells .

4.2. Phosphorylation in Cancer (2018 Study)

  • Method: SILAC-based phosphoproteomics in LS 180 colon cancer cells.

  • Result: Galectin-4 treatment reduced BET1 phosphorylation at Ser50 by threefold, implicating post-translational regulation in tumor suppression .

  • Significance: Links BET1 activity to malignancy-associated metabolic pathways .

Future Directions

Current research focuses on:

  • Elucidating isoform-specific roles in trafficking .

  • Targeting BET1 phosphorylation for cancer therapeutics .

  • Developing high-purity recombinant variants for cryo-EM studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
BET1; BET1 homolog; hBET1; Golgi vesicular membrane-trafficking protein p18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTKLLCYMMLFSLFVFFIIYWIIKLR
Uniprot No.

Target Background

Function
This protein is essential for vesicular transport from the endoplasmic reticulum (ER) to the Golgi complex. It functions as a SNARE protein involved in the docking process of ER-derived vesicles with the cis-Golgi membrane.
Gene References Into Functions
  1. The distinct localizations of rsec22 and rbet1 may reflect their participation in opposite directions of membrane flow between the endoplasmic reticulum and Golgi apparatus. PMID: 8621431
Database Links

HGNC: 14562

OMIM: 605456

KEGG: hsa:10282

STRING: 9606.ENSP00000222547

UniGene: Hs.489132

Protein Families
BET1 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type IV membrane protein. Golgi apparatus, cis-Golgi network membrane. Golgi apparatus membrane.

Q&A

What is BET1 and what is its primary cellular role?

BET1 (also known as Golgi vesicular membrane-trafficking protein p18) is a protein encoded in humans that belongs to the class of Golgi-associated membrane proteins. Its primary function involves mediating vesicular transport from the endoplasmic reticulum (ER) to the Golgi complex . BET1 functions as a soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE), which participates in the docking of ER-derived vesicles to cis-Golgi membranes . This process is essential for proper protein folding, modification, and transport throughout the cell .

The BET1 gene produces multiple transcript variants through variable splicing mechanisms, leading to different isoforms with potentially distinct functional properties . The protein is particularly highly expressed in placental and adrenal gland tissues, suggesting tissue-specific roles .

How is BET1 structurally organized and what are its key domains?

Human BET1 is a relatively small protein with distinct functional domains. Based on experimental data, the protein contains:

  • An N-terminal cytoplasmic region (residues 1-86 in human BET1)

  • A SNARE domain critical for membrane fusion events

  • A C-terminal transmembrane domain that anchors the protein to membranes

Researchers have successfully produced recombinant portions of BET1 for structural studies, particularly focusing on the cytoplasmic regions of human BET1 (residues 1-86) and rat BET1 (residues 1-81) . These regions contain the functionally important SNARE domains that mediate protein-protein interactions essential for vesicular transport.

How evolutionarily conserved is BET1 across species?

BET1 exhibits significant evolutionary conservation across mammalian species, indicating its fundamental importance in cellular function. Sequence comparison between human (hbet1), rat (rbet1), and mouse BET1 homologs reveals substantial similarity . This conservation extends to the functional level, as mammalian BET1 proteins demonstrate homology to the yeast Bet1p protein, which also participates in ER-to-Golgi transport .

Despite this conservation, there are notable differences in subcellular localization between yeast Bet1p (primarily associated with ER and ER-derived vesicles) and mammalian rbet1 (reported to associate with Golgi apparatus) . This distinction raised questions about potential functional divergence during evolution, though subsequent research has clarified many of these functional relationships.

What expression systems are optimal for recombinant human BET1 production?

Researchers have successfully expressed recombinant human BET1 in multiple expression systems, each with distinct advantages depending on experimental needs:

Expression SystemApplicationsPurification LevelNotes
E. coliHigh-yield production, structural studies≥85% by SDS-PAGEGood for cytoplasmic domains
YeastPost-translational modifications≥85% by SDS-PAGEBetter folding for complex domains
BaculovirusHigher eukaryotic modifications≥85% by SDS-PAGESuitable for functional studies
Mammalian CellNative-like modification patterns≥85% by SDS-PAGEIdeal for interaction studies
Cell-Free ExpressionRapid production, difficult proteins≥85% by SDS-PAGEAvoids cellular toxicity issues

For functional studies of the cytoplasmic domain, E. coli expression has been successfully employed to generate GST-fusion proteins (GST-hbet1 and GST-rbet1) . These recombinant proteins have proven valuable for both structural analysis and for generating antibodies against BET1 .

What are the validated methods for detecting BET1 in experimental systems?

Several antibody-based approaches have been validated for detecting BET1 in different experimental contexts:

  • Western Blot: BET1 antibodies have been validated for detecting endogenous BET1 in cell lysates, showing specific bands at the predicted molecular weights of 14 kDa and 10 kDa . Positive Western blot detection has been confirmed in K562 whole cell lysate and rat brain tissue .

  • Immunofluorescence: FITC-conjugated BET1 antibodies have been developed for immunofluorescence applications, allowing visualization of BET1 localization within cellular compartments .

  • Immunoprecipitation: Endogenous co-immunoprecipitation techniques have successfully isolated BET1 and its interaction partners, such as ERGIC-53, confirming their physical association in cellular contexts .

For optimal detection, researchers typically use rabbit polyclonal antibodies against human BET1 at concentrations around 3.4μg/ml, followed by appropriate secondary antibodies (e.g., goat polyclonal to rabbit IgG at 1/50000 dilution) .

How can researchers assess BET1 functionality in vesicular transport assays?

To evaluate BET1 functionality in vesicular transport, researchers have developed several complementary approaches:

  • In vitro transport assays: Semi-intact cell systems can be used to measure protein transport from the ER to Golgi. This involves tracking glycosylation modifications of marker proteins (commonly VSV-G) by SDS-PAGE analysis followed by endoglycosidase H (endo H) digestion . Transport efficiency can be quantified using phosphorimaging techniques .

  • Antibody inhibition assays: BET1 function can be specifically inhibited by adding anti-BET1 antibodies to transport assay systems. The degree of transport inhibition correlates with BET1's functional importance. Specificity can be confirmed by neutralizing the antibody with purified GST-BET1 fusion proteins prior to the assay .

  • Localization studies: Proper BET1 localization is essential for its function. Mislocalization of BET1 (as observed with the p.(Ile51Ser) variant) correlates with functional defects . Colocalization with known markers like ERGIC-53 can be assessed using fluorescence microscopy.

What genetic conditions are associated with BET1 mutations?

Recent research has established BET1 variants as causative factors in severe neuromuscular conditions:

  • Progressive early-onset congenital muscular dystrophy (CMD): Three individuals with biallelic variants in the BET1 gene have been identified with this condition . The disease presents as a severe, early-onset muscular dystrophy with additional features in some cases.

  • CMD with epilepsy: One of the identified patients with BET1 variants presented with both congenital muscular dystrophy and epilepsy, establishing BET1 as a novel CMD/epilepsy gene .

These findings confirm an emerging role for ER-to-Golgi SNARE-mediated transport in muscle homeostasis and disease pathogenesis .

What specific BET1 variants have been identified in patients with CMD?

Two distinct types of disease-causing BET1 variants have been characterized:

  • Compound heterozygous variants: One individual carried the variants c.202G>C; p.(Asp68His) and c.24-11A>G (rs887369401; p.(Met1_Ser8del)) . The missense variant c.202G>C was found to act as a complex splice variant that resulted in reduced BET1 protein levels in patient cells and impaired vesicular traffic .

  • Homozygous missense variant: Two siblings were identified with a homozygous c.152T>G; p.(Ile51Ser) variant . This variant resulted in normal BET1 protein levels but impaired protein function, particularly affecting interactions with partner proteins like ERGIC-53 .

These variants establish distinct molecular mechanisms through which BET1 dysfunction can lead to disease - either through reduced protein expression or through impaired protein-protein interactions.

How do BET1 variants cause disease at the molecular level?

The pathomechanism of BET1-related disorders involves disruption of critical vesicular transport pathways:

  • Reduced protein levels: The c.202G>C variant acts as a complex splice variant causing reduced BET1 protein expression, leading to broadly impaired vesicular trafficking .

  • Impaired protein interactions: The p.(Ile51Ser) variant maintains normal protein levels but interferes with binding to interaction partners beyond the core SNARE complex subunits . This leads to specific defects in certain transport pathways.

  • Protein mislocalization: In fibroblasts derived from patients with the p.(Ile51Ser) variant, both mutant BET1 and its interaction partner ERGIC-53 showed abnormal subcellular localization, disrupting the ERGIC compartment's organization and function .

These findings support a model where precise BET1-mediated transport is essential for muscle and neuronal function, explaining the congenital muscular dystrophy and epilepsy phenotypes observed in affected individuals.

How does BET1 interact with the broader SNARE protein network?

BET1 functions within a complex network of SNARE proteins that collectively mediate specific membrane fusion events:

  • SNARE complex formation: BET1 participates in the formation of specific SNARE complexes that drive fusion of ER-derived vesicles with cis-Golgi membranes . This process involves the precise assembly of complementary SNARE proteins from opposing membranes.

  • Regulatory mechanisms: The activity of BET1-containing SNARE complexes is regulated by multiple factors, including SM (Sec1/Munc18) proteins and post-translational modifications. These regulatory mechanisms ensure the fidelity and timing of vesicular transport events.

  • Integration with transport machinery: BET1 function is coordinated with coat proteins (particularly COPII) that mediate vesicle budding from the ER, ensuring efficient coupling between vesicle formation and subsequent targeting/fusion events.

Understanding these intricate interactions is critical for deciphering how specific BET1 variants disrupt transport pathways and contribute to disease.

What novel interaction partners of BET1 have been identified?

Recent research has expanded our understanding of BET1's interaction network beyond core SNARE proteins:

  • ERGIC-53 interaction: ERGIC-53 has been identified as a novel interaction partner of BET1 through co-immunoprecipitation studies . Both proteins colocalize to the ERGIC (ER-Golgi Intermediate Compartment), suggesting functional cooperation.

  • Differential binding properties: The disease-associated p.(Ile51Ser) variant of BET1 shows reduced affinity for ERGIC-53 compared to wild-type BET1, while maintaining interactions with core SNARE complex components . This selective disruption of protein interactions may explain the specific cellular defects observed.

These findings highlight the importance of looking beyond canonical SNARE interactions to understand BET1's full functional repertoire and its implications for disease.

What cellular consequences result from impaired BET1-mediated transport?

Disruption of BET1-mediated transport has broad implications for cellular function:

  • Protein processing defects: Impaired ER-to-Golgi transport can lead to defective protein processing, particularly affecting proteins requiring Golgi-mediated modifications such as specific glycoproteins.

  • ER stress induction: Blockage of ER export pathways can lead to protein accumulation in the ER, triggering ER stress responses that may contribute to pathology in affected tissues.

  • Tissue-specific vulnerability: Muscle and neuronal tissues appear particularly sensitive to BET1 dysfunction, as evidenced by the congenital muscular dystrophy and epilepsy phenotypes observed in patients with BET1 variants .

Understanding these downstream consequences provides insight into potential therapeutic approaches for BET1-related disorders, possibly including strategies to mitigate ER stress or enhance alternative transport pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.