Recombinant Human Beta-1,3-N-acetylglucosaminyltransferase manic fringe (MFNG)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant MFNG is typically expressed in E. coli or other prokaryotic systems. Key production parameters include:

Production Systems and Tags

Host OrganismTagsSequence CoverageMolecular WeightSource
E. coliN-terminal His-tag, T7-tagSer80-Pro316 (human)30.6–32.5 kDa
E. coliN-terminal His-tagIle56-Tyr309 (rat)~32.5 kDa

Purification: Affinity chromatography (His-tag) followed by lyophilization in PBS with stabilizers (e.g., trehalose, sarcosyl) .

Functional Applications in Research

Recombinant MFNG is used in:

ApplicationMethodKey Findings
Western Blot (WB)Detection of MFNG expression in cell lysatesValidated in human and mouse models .
Immunoprecipitation (IP)Isolation of MFNG protein complexes for interaction studiesIdentified binding partners in Notch signaling pathways .
Notch Signaling AssaysInhibition of Jagged1-mediated Notch activation via MFNG overexpressionRestoring MFNG expression reduces tumorigenicity in cervical cancer cells .

Cancer Research: In HPV-associated cervical neoplasia, MFNG downregulation correlates with Notch pathway activation. Exogenous MFNG expression suppresses tumor growth by inhibiting Jagged1/Notch signaling .

Mechanistic Insights

  • HES1-Mediated Repression: CSL/Notch signaling represses MFNG promoter activity via HES1 binding to N-box elements .

  • Feedback Loops: In cervical neoplasia, Jagged1-induced Notch signaling downregulates MFNG, creating a self-sustaining oncogenic loop .

Therapeutic Potential

StrategyOutcome
MFNG RestorationSuppresses tumorigenicity in cervical cancer cells by inhibiting Notch .
Jagged1 InhibitionBlocks Notch activation, rescuing MFNG expression and reducing tumor burden .

References

  1. Gene Structure and Function: MFNG encodes a glycosyltransferase with conserved β-1,3-N-acetylglucosaminyltransferase activity .

  2. Cancer Research: MFNG downregulation in cervical neoplasia is linked to Notch pathway activation .

  3. Protein Production: Rat MFNG (Ile56-Tyr309) is produced in E. coli with >90% purity .

  4. Human Recombinant MFNG: Ser80-Pro316 fragment expressed in E. coli with His-tag .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MFNG; Beta-1,3-N-acetylglucosaminyltransferase manic fringe; O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-321
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MQCRLPRGLAGALLTLLCMGLLCLRYHLNLSPQRVQGTPELSQPNPGPPKLQLHDVFIAVKTTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLASGLRWFCHVDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASEPQPHNRTRLVQFWFATGGAGFCINRKLALKMAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYPDTPWCPQLGAR
Uniprot No.

Target Background

Function
Manic fringe (MFNG) is a glycosyltransferase initiating the elongation of O-linked fucose residues on the extracellular EGF-like repeats of Notch molecules. It modulates NOTCH1 activity by modifying O-fucose residues within specific EGF-like domains. This results in the inhibition of NOTCH1 activation by JAG1 and the enhancement of NOTCH1 activation by DLL1, mediated by increased DLL1 binding.
Gene References Into Functions
  1. MFNG inversely correlates with Jag1 and Notch expression. High Jag1 levels in the absence of MFNG indicate poor prognosis. PMID: 30065304
  2. MFNG acts as an oncogene via Notch-mediated induction of Pik3cg. PMID: 25808869
  3. MFNG expression is downregulated in Papillomavirus-associated cervical neoplasia. PMID: 15280477
Database Links

HGNC: 7038

OMIM: 602577

KEGG: hsa:4242

STRING: 9606.ENSP00000349490

UniGene: Hs.517603

Protein Families
Glycosyltransferase 31 family
Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.

Q&A

What is the biological function of Manic Fringe (MFNG)?

Manic Fringe (MFNG) functions as an O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase that modifies EGF-like domains in proteins, primarily the Notch receptor. MFNG catalyzes the addition of N-acetylglucosamine (GlcNAc) to O-fucose residues on specific EGF domains, creating O-fucose disaccharides that alter Notch receptor interactions with its ligands . This enzymatic activity represents a critical regulatory mechanism in the Notch signaling pathway, which controls numerous developmental processes including cell fate determination and tissue patterning.

The modification process occurs in the Golgi apparatus where MFNG extends O-fucose monosaccharides by adding GlcNAc. This glycosylation step is part of a sequential modification process that can continue with the addition of galactose and sialic acid by other enzymes, potentially creating tri- and tetrasaccharides with distinct biological effects.

How does MFNG differ from other glycosyltransferases in the Fringe family?

While all Fringe proteins (Manic, Lunatic, and Radical) are β3-N-acetylglucosaminyltransferases that modify O-fucose on EGF repeats, they differ in their expression patterns, substrate preferences, and biological effects on Notch signaling:

Unlike general N-glycan processing enzymes such as MGAT1 that initiate complex N-glycan formation in the Golgi , Fringe proteins specifically recognize and modify O-fucose on EGF-like repeats, showing a distinct substrate specificity that impacts Notch-ligand interactions.

Which EGF domains of Notch are primary targets for MFNG modification?

MFNG preferentially modifies O-fucose residues on specific EGF domains within the Notch receptor, with EGF12 being particularly significant for ligand binding. Research has demonstrated that:

  • EGF12 contains the primary binding site for Notch ligands (Delta-like and Jagged/Serrate)

  • O-fucosylation of EGF12 creates the substrate for MFNG to add GlcNAc

  • This modification significantly alters binding affinities for different ligands

  • Additional EGF domains (EGF26 and EGF27) are also modified by Fringe proteins and influence ligand-mediated Notch activation

The site-specific nature of these modifications explains why different EGF domains exhibit varying sensitivities to Fringe-mediated glycosylation, contributing to the complex regulation of Notch signaling outcomes.

What expression systems are optimal for producing functional recombinant MFNG?

Several expression systems can be used to produce recombinant MFNG, each with specific advantages:

Expression SystemAdvantagesConsiderationsRecommended Applications
Lentiviral Vector SystemsHigh efficiency, stable integration, works in diverse cell typesBiosafety requirements, potential for insertional mutagenesisLong-term expression studies, difficult-to-transfect cells
Mammalian Cell Lines (HEK293, CHO)Proper post-translational modifications, native foldingHigher cost, slower productionFunctional studies requiring authentic enzymatic activity
Bacterial SystemsHigh yield, cost-effectiveLacks glycosylation machinery, potential folding issuesStructural studies after refolding
Baculovirus/Insect CellsHigher yield than mammalian, some PTMsDifferent glycosylation patternsIntermediate between bacterial and mammalian systems

For research requiring enzymatically active MFNG, mammalian expression systems are generally preferred. The commercially available lentiviral expression clone (as seen in search result ) provides an effective means of introducing MFNG into mammalian cells for various applications, with the added benefit of a C-terminal mGFP tag for localization and expression monitoring.

How can researchers detect and measure MFNG enzymatic activity?

Several methodologies are available for assessing MFNG enzymatic activity:

  • Phosphatase-coupled glycosyltransferase assay: This approach, similar to that used for MGAT1 activity measurement , can be adapted for MFNG by using appropriate acceptor substrates containing O-fucose.

  • Mass spectrometry analysis: To directly detect the addition of GlcNAc to O-fucosylated peptides derived from EGF domains.

  • Surface Plasmon Resonance (SPR): This technique can measure how MFNG-mediated glycosylation affects binding between Notch fragments and its ligands . The impact on binding kinetics and affinity constants provides a functional readout of MFNG activity.

  • Flow cytometry: Using fluorescently labeled Notch ligands to detect changes in binding to Notch receptors on cells expressing MFNG, as demonstrated in previous studies .

A typical enzyme activity assay would involve:

  • Incubation of MFNG with O-fucosylated EGF domain-containing substrates

  • Addition of UDP-GlcNAc as the sugar donor

  • Detection of GlcNAc transfer using one of the above methods

  • Comparison with appropriate positive and negative controls

What in vitro glycosylation methods can be used to study MFNG-mediated modifications?

In vitro glycosylation using purified components allows for controlled analysis of MFNG activity. Based on established protocols , the following method is recommended:

  • Prepare unmodified Notch EGF domain fragments (such as hN1 11-13) at approximately 10 μM concentration

  • Add purified Pofut-1 to first establish the O-fucose modification

  • Add purified MFNG and UDP-GlcNAc (200 μM final concentration)

  • Incubate at 37°C overnight

  • For further elongation to trisaccharide or tetrasaccharide:

    • Add UDP-galactose (200 μM) and β4-galactosyltransferase (0.5 mU/μL)

    • For sialylation, further add CMP-sialic acid (200 μM) and α3-sialyltransferase

This sequential glycosylation approach allows researchers to generate defined glycoforms for structural and functional studies, enabling the examination of how each glycosylation step affects Notch-ligand interactions.

How does MFNG-mediated glycosylation affect Notch-ligand interactions?

MFNG modification of O-fucose on Notch EGF domains significantly alters the receptor's interaction with different ligands, with complex and sometimes counterintuitive effects:

  • Effect on Delta-like ligands: MFNG modification generally enhances Notch binding to Delta-like ligands (DLL1, DLL4), with SPR studies showing increased affinity . This enhancement provides a molecular explanation for the biological effects of Fringe proteins in promoting Delta-mediated Notch activation.

  • Effect on Jagged/Serrate ligands: The relationship is more complex. While MFNG modification of EGF12 enhances binding to Jagged1, it may simultaneously reduce signaling activation, suggesting that modification of other EGF domains may counteract this effect .

  • Differential effects on ligands: The interaction with DLL4 shows higher inherent affinity even without MFNG modification, explaining why glycosylation effects may be less pronounced for this ligand in some experimental systems .

Quantitative data from SPR experiments demonstrates how these interactions are modulated:

Notch ConstructLigandWithout MFNG ModificationWith MFNG ModificationEffect
hN1 11-13DLL1KD > 50 μMSignificantly tighter bindingEnhancement
hN1 11-13Jagged1 NE3KD > 50 μMTighter bindingEnhancement
hN1 11-13DLL4 NE3Tighter than other ligandsSimilar to unmodifiedMinimal change
hN1 1-14FcJagged1 NE3KD = 7.1 ± 0.1 μMVaries by EGF domainComplex

These findings highlight the importance of studying glycosylation effects on specific EGF domains to understand the complete picture of Notch regulation.

How can researchers distinguish between effects of MFNG and other Fringe family proteins?

To differentiate between the effects of MFNG and other Fringe proteins (Lunatic and Radical), researchers should implement the following approaches:

  • Selective knock-down/knock-out experiments: Using siRNA or CRISPR-Cas9 to specifically target individual Fringe proteins.

  • Rescue experiments: Complementing Fringe-deficient systems with individual recombinant Fringe proteins to identify specific contributions.

  • Domain swapping: Creating chimeric proteins by exchanging domains between Fringe family members to identify regions responsible for substrate specificity and catalytic differences.

  • In vitro comparison: Using purified enzymes to directly compare glycosylation efficiency and substrate preferences under identical conditions.

  • Structural biology approaches: X-ray crystallography or cryo-EM studies of different Fringe proteins with their substrates to identify structural determinants of specificity.

A systematic experimental design might involve expressing tagged versions of each Fringe protein (similar to the MFNG construct described in ) and comparing their effects on Notch-ligand interactions using both cellular and biochemical assays.

What methods are available for studying the kinetics of MFNG-catalyzed reactions?

Several sophisticated approaches can be employed to study the enzymatic kinetics of MFNG:

  • Radiometric assays: Using radiolabeled UDP-GlcNAc to track the transfer of GlcNAc to acceptor substrates over time.

  • HPLC-based methods: Monitoring the formation of glycosylated products and consumption of substrates in real-time.

  • Bioluminescence UDP detection: Coupling the release of UDP during glycosyl transfer to a luminescence-generating reaction for continuous monitoring.

  • Surface Plasmon Resonance (SPR): When combined with stopped-flow techniques, SPR can provide real-time kinetic data on binding events influenced by MFNG glycosylation .

  • NMR spectroscopy: For detailed mechanistic studies of enzyme-substrate interactions and conformational changes during catalysis.

To determine key kinetic parameters like KM and kcat, researchers should:

  • Use varying concentrations of both UDP-GlcNAc and O-fucosylated peptide substrates

  • Measure initial reaction velocities under steady-state conditions

  • Analyze data using appropriate enzyme kinetics models (Michaelis-Menten, bi-substrate kinetics)

  • Account for potential product inhibition effects

What are common challenges in expressing and purifying functional recombinant MFNG?

Researchers frequently encounter several challenges when working with recombinant MFNG:

  • Low expression levels: As a glycosyltransferase, MFNG expression may be limited by its natural regulatory mechanisms. Solution: Optimize codon usage for the expression system and consider using stronger promoters or inducible systems.

  • Inclusion body formation in bacterial systems: MFNG may fold incorrectly in prokaryotic expression systems. Solution: Express in mammalian cells or use specialized bacterial strains designed for disulfide bond formation.

  • Loss of activity during purification: The enzyme may lose activity due to removal of essential cofactors. Solution: Include stabilizing agents and avoid harsh elution conditions during purification.

  • Aggregation: MFNG may aggregate during concentration steps. Solution: Include low concentrations of detergents or glycerol in storage buffers.

  • Variability in glycosylation state: When expressed in different systems, MFNG itself may have variable glycosylation affecting its function. Solution: Use a consistent expression system and characterize the glycosylation state of the purified enzyme.

The lentiviral expression system described in source offers advantages for mammalian expression, including the mGFP tag for monitoring expression and the puromycin selection marker for generating stable cell lines.

How can researchers validate the functionality of recombinant MFNG preparations?

To ensure recombinant MFNG is functionally active, researchers should implement a multi-step validation process:

  • Enzymatic activity assay: Test the ability of purified MFNG to transfer GlcNAc to a known O-fucosylated substrate, using methods described in section 2.2.

  • Notch-ligand binding assay: Verify that MFNG-modified Notch fragments show the expected changes in binding affinity to Delta and Jagged ligands using SPR or flow cytometry .

  • Mass spectrometry validation: Confirm the correct addition of GlcNAc to specific residues on target substrates.

  • Cellular Notch reporter assay: In a cellular context, determine whether MFNG expression modulates Notch signaling as expected when cells are exposed to Delta or Jagged ligands.

  • Comparison with positive control: Include commercially available or well-characterized MFNG preparations as benchmarks.

A typical validation workflow should progress from biochemical to cellular assays, ensuring that the recombinant protein demonstrates the expected activities in increasingly complex biological contexts.

What controls should be included in experiments studying MFNG effects on Notch signaling?

Robust experimental design for studying MFNG effects requires several critical controls:

  • Enzyme activity controls:

    • Positive control: Known active glycosyltransferase with similar activity (e.g., Lunatic Fringe)

    • Negative control: Heat-inactivated MFNG or catalytically inactive mutant

  • Substrate controls:

    • Wild-type Notch fragments containing O-fucosylation sites

    • Mutant Notch fragments with O-fucosylation sites eliminated

  • Glycosylation state controls:

    • Unmodified Notch (no O-fucose)

    • O-fucosylated Notch (modified by Pofut-1 only)

    • Fully glycosylated Notch (O-fucose extended with GlcNAc, Gal, and sialic acid)

  • Ligand interaction controls:

    • Binding to multiple ligands (DLL1, DLL4, Jagged1) to show ligand-specific effects

    • Concentration gradients of ligands to determine affinity changes

  • Cellular signaling controls:

    • MFNG knockout/knockdown cells

    • Cells expressing enzymatically inactive MFNG

    • Treatment with specific glycosylation inhibitors

Including these comprehensive controls allows researchers to distinguish direct effects of MFNG-mediated glycosylation from indirect or non-specific effects in their experimental systems.

How is MFNG being applied in developmental biology research?

MFNG has become an important tool for studying developmental processes governed by Notch signaling:

  • Boundary formation studies: Researchers use MFNG to investigate how glycosylation-dependent modulation of Notch signaling contributes to the establishment of developmental boundaries between different cell populations.

  • Stem cell differentiation: Manipulation of MFNG levels can be used to direct stem cell fate decisions through altered Notch signaling dynamics.

  • Organoid development: MFNG expression in 3D culture systems helps recapitulate developmental processes and tissue patterning in vitro.

  • Genetic rescue experiments: Introduction of recombinant MFNG in Fringe-deficient models allows researchers to determine the specific contributions of this enzyme to developmental phenotypes.

  • Synthetic developmental biology: Engineered MFNG variants with altered specificity or activity can be used to create novel developmental outcomes through precise manipulation of Notch signaling.

The lentiviral expression system described in source is particularly valuable for these applications as it allows stable integration and long-term expression of MFNG in developing tissues and organoids.

What techniques are being developed to study site-specific effects of MFNG glycosylation?

Advanced techniques for investigating site-specific glycosylation effects include:

These sophisticated approaches build upon fundamental methods like SPR and flow cytometry , allowing researchers to move beyond simple binding studies to understand the structural and molecular basis of MFNG's effects on Notch signaling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.