Recombinant Human Beta-galactoside alpha-2,6-sialyltransferase 1 (ST6GAL1)-VLPs

Shipped with Ice Packs
In Stock

Product Specs

Buffer
Lyophilized from PBS, containing 6% Trehalose, pH 7.4.
Form
Lyophilized powder
Note: We will default ship the product in lyophilized form with standard blue ice packs. However, if you require shipment in liquid form, it needs to be shipped with dry ice. Please communicate with us in advance as extra fees for dry ice and a dry ice box will be charged.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributor for specific delivery times.
Note: Delivery time may vary depending on the purchase method or location. Please contact your local distributors for specific delivery times.
Notes
Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receipt and ensure to avoid repeated freezing and thawing, as this can negatively affect the protein activity.
Shelf Life
The shelf life of the product is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein itself. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
C-terminal 10xHis-tagged
If you require a specific tag type, please inform us, and we will investigate its feasibility.
Synonyms
ST6GAL1; SIAT1; Beta-galactoside alpha-2,6-sialyltransferase 1; Alpha 2,6-ST 1; B-cell antigen CD75; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1; ST6Gal I; ST6GalI; Sialyltransferase 1
Datasheet & Coa
Please contact us to get it.
Expression Region
1-406aa
Research Area
Immunology
Source
Mammalian cell
Species
Homo sapiens (Human)
Target Names
ST6GAL1
Target Protein Sequence
MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Transfers sialic acid from CMP-sialic acid to galactose-containing acceptor substrates.
Gene References Into Functions
  1. While ST6GalI overexpression led to increased HER2 sialylation, corresponding to decreased HER2 phosphorylation, high alpha2,6-sialylation enhanced Akt and ERK phosphorylation levels compared to those in the vector cell line. Conversely, ST6GalI knockdown had the opposite effects. These findings suggest a functional role of ST6GalI in promoting tumor cell progression and trastuzumab resistance. PMID: 30226606
  2. Cells cultured in hypoxia for extended periods exhibited enriched ST6Gal-I expression, aligning with a pro-survival function. Collectively, these findings unveil a glycosylation-dependent mechanism that facilitates tumor cell adaptation to a hypoxic environment. PMID: 29475939
  3. By retaining TNFR1 at the cell surface through sialylation, ST6Gal-I acts as a functional switch to redirect signaling towards survival. These findings collectively point to a novel glycosylation-dependent mechanism that regulates the cellular response to TNF and potentially promotes cancer cell survival within TNF-rich tumor microenvironments. PMID: 29233887
  4. ST6GAL1 could be a potential target for atherosclerosis prevention and treatment. PMID: 29654763
  5. We identified three significant associations at rs6679677 on 1p13.2 (P=6.15x10-5, OR=5.07), rs16861329 on 3q27.3 (P=2.02x10-4, OR=0.87), and rs849135 on 7p15.1 (P=6.59x10-9, OR=1.78), suggesting PTPN22, ST6GAL1, and JAZF1 as novel susceptibility genes for psoriasis in the Chinese population. PMID: 28603863
  6. Suggesting a crucial role for ST6Gal1 in elevating the invasiveness of pancreatic ductal adenocarcinoma cells in a fructose-responsive manner. PMID: 28032597
  7. These results indicate that ST6Gal-I plays a crucial role in cell proliferation and invasion via the PI3K/Akt/GSK-3beta/beta-catenin signaling pathway during cancer progression. PMID: 27588482
  8. These findings suggest that ST6Gal-I might play a positive role in mediating the survival of human hepatocarcinoma cells. PMID: 27340870
  9. The results demonstrate that epigenetic modulation of ST6Gal1 expression plays a key role in the glioma phenotype in vitro and that therapeutic approaches targeting elements of the epigenetic machinery for the treatment of human glioblastoma are warranted. PMID: 27510958
  10. The data confirm that circulatory ST6Gal-1 is a negative systemic regulator of granulopoiesis. PMID: 28550122
  11. Results provide evidence that ST6GAL1 contributes to drug resistance in cervical neoplasm. PMID: 27986075
  12. High ST6GAL1 expression is associated with ovarian and pancreatic Cancers. PMID: 27216178
  13. ST3Gal I and ST6Gal I have different sialic acid donor specificity. PMID: 28395125
  14. Taken together, these results indicate a dynamic change in the expression of ST6GAL1 during CRC progression and provide a list of sialylated proteins potentially relevant to the different functions of ST6GAL1 in CRC. PMID: 28377225
  15. The results presented in this study provide an important advance by highlighting a new function for ST6Gal-I in promoting the viability of tumor cells exposed to the type of serum-depleted conditions often found in hypovascularized tumor microenvironments. PMID: 28154177
  16. High ST6GAL1 expression is associated with aging. PMID: 26840264
  17. Collectively, our data indicate that ST6GAL1 plays an important role in the regulation of pluripotency and differentiation in hPSCs. PMID: 26304831
  18. These results suggest a role for ST6Gal-I in promoting the growth and invasion of osteosarcoma cells. PMID: 26054692
  19. Data indicate that O-glycan-specific alpha2,6 sialyltransferase regulate cancer growth and metastasis by regulating galectins Gal-1- and Gal-3-binding moieties on O-glycans. PMID: 26224120
  20. Expression levels of sialyltransferases ST3GAL1 and ST3GAL4 were upregulated in the HRMECs after high-glucose stimulation. PMID: 26258617
  21. Sialylation by beta-galactoside alpha-2,6-sialyltransferase regulates cell adhesion and invasion in human anaplastic large cell lymphoma. PMID: 25573487
  22. CDX2 transcriptionally regulates ST6GalNAc-I gene expression, specifically in the preneoplastic intestinal metaplasia lesion. PMID: 25867765
  23. Study characterizes ST6GAL1 expression loss caused by aberrant ST6GAL1 promoter methylation potentially indicating a tumor suppressive role in bladder carcinogenesis. PMID: 25465919
  24. ST6GAL1 promotes TGF-beta-dependent epithelial-mesenchymal transition. PMID: 25344606
  25. The lymphocyte levels of NEU1 and ST6GAL1 mRNA expression are significantly increased in erythremia. PMID: 25566667
  26. The study detected only one allele of each polymorphism in the ST6GAL1P1 promoter. PMID: 24606438
  27. ST6GAL1 is responsible for the development of multidrug resistance in human leukemia cells probably through mediating the activity of PI3K/Akt signaling. PMID: 24454800
  28. A large glycan from a symmetry mate localizes to the active site of ST6Gal-I in an orientation compatible with catalysis. The glycan binding mode can be generalized to any glycoprotein that is a substrate of ST6Gal-I. PMID: 23999306
  29. The high expression of ST3Gal I and ST6Gal I, in skin tumors, is associated with tumors with greater potential for invasion and metastasis, as in the case of squamous cell carcinoma, and this may be related to their behavior. PMID: 23549466
  30. ST6Gal-I protein expression is upregulated in epithelial tumors. PMID: 23358684
  31. The suppressive role of Necl-2 in the HRG-induced ErbB2/ErbB3 signaling is regulated by miR-199a at least through the reduction of the ST6GAL1-catalyzed sialylation of Necl-2. PMID: 23504322
  32. These results indicated that gastric cancer tissues expressed high levels of alpha 2,3-linked sialic acid residues, ST3Gal IV, and ST6Gal I. PMID: 21140242
  33. Our results suggest that soluble ST6Gal may participate in cancer progression and metastasis prior to being secreted from cancer cells. PMID: 22449099
  34. ST6Gal-I regulates macrophage apoptosis via alpha2-6 sialylation of the TNFR1 death receptor. PMID: 21930713
  35. CDw75 expression in colorectal tumoral tissue was correlated with growth pattern (p = 0.044), Dukes stage (p = 0.002), TNM stage (p = 0.020), and distant metastasis (p = 0.005). PMID: 21778787
  36. The occurrence of CD75s- and iso-CD75s-gangliosides in tumor tissues is largely independent of the transcriptional expression of ST6GAL1 and ST3GAL6. PMID: 21147760
  37. Sialylation of the Fas death receptor by ST6Gal-I provides protection against Fas-mediated apoptosis in colon carcinoma cells. PMID: 21550977
  38. ST6Gal I is responsible for ST2H antigen biosynthesis in human colon cancer cells. PMID: 20656882
  39. siRNA targeting to ST6Gal I can effectively downregulate the ST6Gal I expression in HeLa cells and further lead to the decline of cell adhesion and invasiveness to ECM. PMID: 17441333
  40. ST6Gal I and ST3Gal V were positively correlated with the high risk of pediatric acute leukemia. PMID: 19709745
  41. Enhanced tumor ST6Gal I activity and an increased CDw75 expression may play a role in the malignant transformation of colorectal cancer. PMID: 20003255
  42. ST6Gal I sialyltransferase has a role in regulating galectin-1-induced CD45 clustering, phosphatase modulation, and T cell death. PMID: 12499376
  43. Expression of alpha 2,6-sialyltransferase ST6Gal I is enhanced in cervical squamous cell carcinoma. PMID: 12798701
  44. Transcriptional activation of beta-galactoside alpha2,6-sialyltransferase in colon adenocarcinoma cells. PMID: 12878221
  45. High levels of ST6GAL-I in the tumor tissue correlated with secondary local tumor recurrence (p = 0.005; p = 0.012). PMID: 12931020
  46. Specific kinase enzymes have important roles in the expression and catalytic activity of the alpha2,6 STN (ST6N) isozyme. PMID: 12943659
  47. Neoplastic transformation but not cirrhosis can alter the process of alpha2,6-sialylation of liver glycoproteins. PMID: 14514712
  48. Sialyltransferases expression and activity are increased in Grave's disease. PMID: 16053379
  49. The presence of alpha2,6-linked sialic acid added by ST6Gal.I on membrane glycoconjugates increases the binding to extracellular matrix components, resulting in a membrane stabilization of beta1 integrins, further strengthening the binding. PMID: 16192407
  50. ST6Gal I is upregulated in tumor and transitional tissues from colorectal cancer patients. PMID: 16319516

Show More

Hide All

Database Links

HGNC: 10860

OMIM: 109675

KEGG: hsa:6480

STRING: 9606.ENSP00000169298

UniGene: Hs.207459

Protein Families
Glycosyltransferase 29 family
Subcellular Location
Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Secreted. Note=Membrane-bound form in trans cisternae of Golgi. Secreted into the body fluid.

Q&A

What is ST6GAL1 and what is its primary enzymatic function?

ST6GAL1 (Beta-galactoside alpha-2,6-sialyltransferase 1) is an enzyme that catalyzes the addition of α2-6 linked sialic acids to N-glycosylated proteins. This sialyltransferase plays a critical role in the post-translational modification of numerous glycoproteins, affecting their stability, recognition properties, and biological functions. The enzyme typically resides in the Golgi apparatus where it co-localizes with Golgi markers such as GM-130, as demonstrated through immunocytochemistry studies in various cell lines. The enzyme's catalytic domain corresponds to amino acids 44-406 (Glu44-Cys406), and recombinant forms often include an N-terminal 6-His tag for purification purposes .

When designing experiments with ST6GAL1, researchers should consider its natural subcellular localization and optimal enzymatic conditions, particularly if engineering fusion constructs or attempting to express the enzyme in heterologous systems. The enzyme requires CMP-NeuAc as a donor substrate, with a reported Km value of approximately 0.5 mM .

How is ST6GAL1 expression regulated in different tissues and disease states?

ST6GAL1 expression varies significantly across tissues and is dysregulated in multiple pathological conditions. In normal human tissues, ST6GAL1 is highly expressed in liver hepatocytes and prostate glandular epithelial cells, where it localizes primarily to the cytoplasm . The regulation of ST6GAL1 expression is multifactorial, involving genetic, epigenetic, transcriptional, and posttranslational mechanisms .

In cancer, ST6GAL1 is frequently overexpressed, promoting tumor cell behaviors such as invasion, EMT, and resistance to various cytotoxic stimuli including chemotherapy drugs, radiation, and serum deprivation . Interestingly, while ST6GAL1 generally plays oncogenic roles, tumor-suppressive functions have been reported in certain cancer types, such as advanced bladder cancer where ST6GAL1 expression is downregulated . This context-dependent function suggests that experimental interventions targeting ST6GAL1 should be carefully evaluated in each specific disease model.

When designing ST6GAL1-related experiments, researchers should consider tissue-specific expression patterns and regulatory mechanisms that might influence their results. Control experiments should include relevant tissue samples and appropriate disease model comparisons.

What are the most reliable methods for detecting and quantifying ST6GAL1 in experimental samples?

Multiple complementary approaches can be employed for robust ST6GAL1 detection and quantification:

Western Blot Analysis:
ST6GAL1 is typically detected as a band of approximately 56-64 kDa depending on the experimental system used. Using Daudi human Burkitt's lymphoma cell lysates, ST6GAL1 appears at approximately 56 kDa in traditional Western blot and 64 kDa in Simple Western systems . For optimal detection, use:

  • 1 μg/mL of anti-ST6GAL1 antibody (e.g., Goat Anti-Human ST6GAL1 Antigen Affinity-purified Polyclonal Antibody) for traditional Western blot

  • 10 μg/mL of antibody for Simple Western detection

  • Reducing conditions and appropriate buffer systems (e.g., Immunoblot Buffer Group 8)

Immunohistochemistry/Immunocytochemistry:
For tissue localization studies:

  • Use 0.3-1 μg/mL of anti-ST6GAL1 antibody

  • Perform heat-induced epitope retrieval using basic antigen retrieval reagents

  • Visualize with appropriate secondary antibodies and DAB staining

  • Counterstain with hematoxylin for structural context

Enzymatic Activity Assays:
Functional ST6GAL1 activity can be measured using phosphatase-coupled sialyltransferase assays with CMP-NeuAc as the donor substrate .

Detection MethodSample TypeMolecular WeightAntibody ConcentrationKey Considerations
Western BlotCell lysates~56 kDa1 μg/mLReducing conditions required
Simple WesternCell lysates~64 kDa10 μg/mL12-230 kDa separation system
IHC - LiverFFPE sectionsN/A0.3 μg/mLCytoplasmic localization in hepatocytes
IHC - ProstateFFPE sectionsN/A1 μg/mLCytoplasmic localization in epithelial cells
ICCCultured cellsN/AVariableCo-staining with Golgi markers recommended

How can ST6GAL1 expression be effectively modulated in experimental models?

Multiple strategies have been successfully employed to modulate ST6GAL1 expression in research models:

Overexpression Systems:

  • Lentiviral transduction using ST6GAL1-expressing vectors has proven effective in multiple cell lines, such as OV4 ovarian cancer cells that naturally lack endogenous ST6GAL1

  • Verify successful overexpression through both immunocytochemistry and immunoblotting

  • Confirm proper Golgi localization by co-staining with Golgi markers like GM-130

Knockdown Approaches:

  • shRNA-mediated knockdown via lentiviral delivery has been successfully used in cell lines with high endogenous ST6GAL1 expression, such as Pa-1 ovarian cancer cells

  • Validate knockdown efficiency through both protein detection methods and functional assays measuring sialyltransferase activity

  • Consider potential compensatory mechanisms when interpreting long-term knockdown studies

Tissue-Specific Knockout Models:

  • Germline ablation of ST6GAL1 in mice results in complete loss of IgG α2-6-sialylation

  • Hepatocyte-specific or B cell-specific knockouts have been generated to investigate tissue-specific functions of ST6GAL1

  • These models reveal that neither hepatocyte nor B cell expression alone is essential for IgG sialylation, suggesting alternative sources

When designing expression modulation experiments, researchers should carefully consider:

  • Cell-type specific baseline expression levels

  • Appropriate controls (empty vector, scrambled shRNA)

  • Potential compensatory mechanisms

  • Verification through multiple detection methods

  • Functional validation of enzyme activity changes

How does ST6GAL1 contribute to cancer chemoresistance mechanisms?

ST6GAL1 has been implicated in chemoresistance across multiple cancer types, with particularly strong evidence in ovarian cancer models. Several key findings demonstrate this relationship:

  • Pa-1 ovarian cancer cells with ST6GAL1 knockdown, when exposed to cisplatin for three weeks, show upregulation of ST6GAL1 in the surviving resistant population (sh.ST6 cis-res)

  • Short-term cisplatin treatment (24 hours) does not induce ST6GAL1 upregulation in knockdown cells, suggesting that ST6GAL1 expression is associated with the selection of resistant clones rather than acute stress response

  • A2780 ovarian cancer cells resistant to cisplatin display higher endogenous ST6GAL1 levels compared to parental cell lines

These findings suggest that ST6GAL1 may be part of an adaptive response enabling cancer cells to survive chemotherapy treatment. Mechanistically, ST6GAL1-mediated sialylation may protect against apoptosis through altering cell surface receptor function, modifying death receptor signaling, or affecting intracellular signaling pathways .

When designing studies to investigate ST6GAL1's role in chemoresistance, researchers should:

  • Compare matched sensitive and resistant cell line pairs

  • Evaluate both acute and chronic drug exposure effects

  • Assess whether ST6GAL1 modulation directly affects drug sensitivity

  • Identify which specific glycoprotein substrates mediate the resistance phenotype

What is known about ST6GAL1's role in modulating immune responses?

ST6GAL1-mediated sialylation significantly impacts immune function through multiple mechanisms:

These findings highlight the complex interplay between ST6GAL1 activity and immune function, suggesting that therapeutic strategies targeting this enzyme must carefully consider potential immunomodulatory effects.

What are the critical considerations when incorporating ST6GAL1 into virus-like particle (VLP) systems?

When developing ST6GAL1-VLP systems, researchers should address several critical parameters:

Enzyme Orientation and Activity:

  • The orientation of ST6GAL1 relative to the VLP surface is crucial for maintaining enzymatic activity

  • Consider whether ST6GAL1 should be displayed on the external surface (for substrate accessibility) or encapsulated (for protected delivery)

  • Fusion strategies must preserve the catalytic domain (amino acids 44-406) while providing sufficient flexibility through appropriate linker sequences

Buffer Compatibility:

  • VLP assembly conditions must be compatible with ST6GAL1 stability and activity

  • The recombinant ST6GAL1 product has been noted to require buffer optimization to remove components toxic to cells, suggesting careful consideration of formulation for VLP applications

Functional Validation:

  • Comprehensive characterization of ST6GAL1-VLP constructs should include:

    • Validation of proper enzyme folding and activity on the VLP platform

    • Confirmation of VLP morphology and stability using electron microscopy

    • Assessment of sialyltransferase activity using appropriate donor (CMP-NeuAc) and acceptor substrates

    • Evaluation of cellular uptake and intracellular trafficking of the ST6GAL1-VLPs

Strategic Applications:

  • ST6GAL1-VLPs could potentially serve as delivery vehicles for enzyme replacement therapy

  • They may function as tools for targeted sialylation of specific cell populations

  • Consider how ST6GAL1-VLPs might interact with Siglec-expressing immune cells, potentially modulating immune responses

How should researchers address contradictory findings regarding ST6GAL1's role in different experimental systems?

Researchers attempting to reconcile contradictory findings about ST6GAL1 should consider:

When designing experiments to resolve contradictory findings, researchers should:

  • Include multiple complementary methodologies

  • Compare results across different cell types or tissues

  • Evaluate both short-term and long-term effects

  • Consider potential compensatory mechanisms

  • Clearly define the specific substrate proteins being studied

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.