Recombinant Human Beta-galactoside alpha-2,6-sialyltransferase 1 (ST6GAL1)

Shipped with Ice Packs
In Stock

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based solution containing 5%-50% glycerol.
Please note: If you have specific requirements for the glycerol content, kindly indicate them in your order remarks.
For lyophilized powder delivery forms, the buffer used prior to lyophilization is a Tris/PBS-based solution containing 6% Trehalose.
Form
The protein is available in either liquid or lyophilized powder form.
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify it in your order remarks, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life of the protein is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 6xHis-tagged
Synonyms
ST6GAL1; SIAT1; Beta-galactoside alpha-2,6-sialyltransferase 1; Alpha 2,6-ST 1; B-cell antigen CD75; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1; ST6Gal I; ST6GalI; Sialyltransferase 1
Datasheet & Coa
Please contact us to get it.
Expression Region
1-406aa
Mol. Weight
52.1kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Immunology
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
ST6GAL1
Target Protein Sequence
MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Recombinant Human Beta-galactoside alpha-2,6-sialyltransferase 1 (ST6GAL1) catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing acceptor substrates.
Gene References Into Functions
  1. Overexpression of ST6GalI increased HER2 sialylation, leading to decreased HER2 phosphorylation. However, high alpha2,6-sialylation enhanced Akt and ERK phosphorylation levels compared to the vector cell line. Conversely, ST6GalI knockdown exhibited opposite effects. Collectively, these findings suggest a functional role of ST6GalI in promoting tumor cell progression and trastuzumab resistance. PMID: 30226606
  2. Cells grown in hypoxia for extended periods exhibited enriched ST6Gal-I expression, aligning with a pro-survival function. These findings reveal a glycosylation-dependent mechanism facilitating tumor cell adaptation to a hypoxic environment. PMID: 29475939
  3. By restraining TNFR1 at the cell surface through sialylation, ST6Gal-I acts as a functional switch, diverting signaling towards survival. These findings highlight a novel glycosylation-dependent mechanism that regulates the cellular response to TNF and potentially promotes cancer cell survival within TNF-rich tumor microenvironments. PMID: 29233887
  4. ST6GAL1 could be a potential target for atherosclerosis prevention and treatment. PMID: 29654763
  5. Three significant associations were discovered at rs6679677 on 1p13.2 (P=6.15x10-5, OR=5.07), rs16861329 on 3q27.3 (P=2.02x10-4, OR=0.87), and rs849135 on 7p15.1 (P=6.59x10-9, OR=1.78), suggesting PTPN22, ST6GAL1, and JAZF1 as novel susceptibility genes for psoriasis in the Chinese population. PMID: 28603863
  6. These findings suggest a crucial role for ST6Gal1 in enhancing the invasiveness of pancreatic ductal adenocarcinoma cells in a fructose-responsive manner. PMID: 28032597
  7. These results indicate that ST6Gal-I plays a critical role in cell proliferation and invasion via the PI3K/Akt/GSK-3beta/beta-catenin signaling pathway during cancer progression. PMID: 27588482
  8. These results suggest that ST6Gal-I might play a positive role in mediating the survival of human hepatocarcinoma cells. PMID: 27340870
  9. The results demonstrate that epigenetic modulation of ST6Gal1 expression plays a key role in the glioma phenotype in vitro, indicating that therapeutic approaches targeting elements of the epigenetic machinery for the treatment of human glioblastoma are warranted. PMID: 27510958
  10. The data confirm that circulatory ST6Gal-1 is a negative systemic regulator of granulopoiesis. PMID: 28550122
  11. Results provide evidence that ST6GAL1 contributes to drug resistance in cervical neoplasm. PMID: 27986075
  12. High ST6GAL1 expression is associated with ovarian and pancreatic cancers. PMID: 27216178
  13. ST3Gal I and ST6Gal I exhibit different sialic acid donor specificity. PMID: 28395125
  14. These results indicate a dynamic change in the expression of ST6GAL1 during CRC progression and provide a list of sialylated proteins potentially relevant to the different functions of ST6GAL1 in CRC. PMID: 28377225
  15. The results presented in this study provide an important advance by highlighting a new function for ST6Gal-I in promoting the viability of tumor cells exposed to serum-depleted conditions often found in hypovascularized tumor microenvironments. PMID: 28154177
  16. High ST6GAL1 expression is associated with aging. PMID: 26840264
  17. Our data indicate that ST6GAL1 plays a significant role in the regulation of pluripotency and differentiation in hPSCs. PMID: 26304831
  18. These results suggest a role for ST6Gal-I in promoting the growth and invasion of osteosarcoma cells. PMID: 26054692
  19. Data indicate that O-glycan-specific alpha2,6 sialyltransferase regulates cancer growth and metastasis by regulating galectins Gal-1- and Gal-3-binding moieties on O-glycans. PMID: 26224120
  20. Expression levels of sialyltransferases ST3GAL1 and ST3GAL4 were upregulated in the HRMECs after high-glucose stimulation. PMID: 26258617
  21. Sialylation by beta-galactoside alpha-2,6-sialyltransferase regulates cell adhesion and invasion in human anaplastic large cell lymphoma. PMID: 25573487
  22. CDX2 transcriptionally regulates ST6GalNAc-I gene expression, specifically in the preneoplastic intestinal metaplasia lesion. PMID: 25867765
  23. This study characterizes ST6GAL1 expression loss caused by aberrant ST6GAL1 promoter methylation, potentially indicating a tumor suppressive role in bladder carcinogenesis. PMID: 25465919
  24. ST6GAL1 promotes TGF-beta-dependent epithelial-mesenchymal transition. PMID: 25344606
  25. The lymphocyte levels of NEU1 and ST6GAL1 mRNA expression are significantly increased in erythremia. PMID: 25566667
  26. The study detected only one allele of each polymorphism in the ST6GAL1P1 promoter. PMID: 24606438
  27. ST6GAL1 is responsible for the development of multidrug resistance in human leukemia cells, likely through mediating the activity of PI3K/Akt signaling. PMID: 24454800
  28. A large glycan from a symmetry mate localizes to the active site of ST6Gal-I in an orientation compatible with catalysis. The glycan binding mode can be generalized to any glycoprotein that is a substrate of ST6Gal-I. PMID: 23999306
  29. The high expression of ST3Gal I and ST6Gal I in skin tumors is associated with tumors with greater potential for invasion and metastasis, as in the case of squamous cell carcinoma, and this may be related to their behavior. PMID: 23549466
  30. ST6Gal-I protein expression is upregulated in epithelial tumors. PMID: 23358684
  31. The suppressive role of Necl-2 in the HRG-induced ErbB2/ErbB3 signaling is regulated by miR-199a at least through the reduction of the ST6GAL1-catalyzed sialylation of Necl-2. PMID: 23504322
  32. These results indicated that gastric cancer tissues expressed high levels of alpha 2,3-linked sialic acid residues, ST3Gal IV, and ST6Gal I. PMID: 21140242
  33. Our results suggest that soluble ST6Gal may participate in cancer progression and metastasis prior to being secreted from cancer cells. PMID: 22449099
  34. ST6Gal-I regulates macrophage apoptosis via alpha2-6 sialylation of the TNFR1 death receptor. PMID: 21930713
  35. CDw75 expression in colorectal tumor tissue was correlated with growth pattern (p = 0.044), Dukes stage (p = 0.002), TNM stage (p = 0.020), and distant metastasis (p = 0.005). PMID: 21778787
  36. The occurrence of CD75s- and iso-CD75s-gangliosides in tumor tissues is largely independent of the transcriptional expression of ST6GAL1 and ST3GAL6. PMID: 21147760
  37. Sialylation of the Fas death receptor by ST6Gal-I provides protection against Fas-mediated apoptosis in colon carcinoma cells. PMID: 21550977
  38. ST6Gal I is responsible for ST2H antigen biosynthesis in human colon cancer cells. PMID: 20656882
  39. siRNA targeting to ST6Gal I can effectively downregulate the ST6Gal I expression in HeLa cells, further leading to a decline in cell adhesion and invasiveness to ECM. PMID: 17441333
  40. ST6Gal I and ST3Gal V were positively correlated with the high risk of pediatric acute leukemia. PMID: 19709745
  41. Enhanced tumor ST6Gal I activity and increased CDw75 expression may play a role in the malignant transformation of colorectal cancer. PMID: 20003255
  42. ST6Gal I sialyltransferase has a role in regulating galectin-1-induced CD45 clustering, phosphatase modulation, and T cell death. PMID: 12499376
  43. Expression of alpha 2,6-sialyltransferase ST6Gal I is enhanced in cervical squamous cell carcinoma. PMID: 12798701
  44. Transcriptional activation of beta-galactoside alpha2,6-sialyltransferase in colon adenocarcinoma cells. PMID: 12878221
  45. High levels of ST6GAL-I in the tumor tissue correlated with secondary local tumor recurrence (p = 0.005; p = 0.012). PMID: 12931020
  46. Specific kinase enzymes have important roles in the expression and catalytic activity of the alpha2,6 STN (ST6N) isozyme. PMID: 12943659
  47. Neoplastic transformation, but not cirrhosis, can alter the process of alpha2,6-sialylation of liver glycoproteins. PMID: 14514712
  48. Sialyltransferases expression and activity are increased in Grave's disease. PMID: 16053379
  49. The presence of alpha2,6-linked sialic acid added by ST6Gal.I on membrane glycoconjugates increases binding to extracellular matrix components, resulting in membrane stabilization of beta1 integrins, further strengthening the binding. PMID: 16192407
  50. ST6Gal I is upregulated in tumor and transitional tissues from colorectal cancer patients. PMID: 16319516

Show More

Hide All

Database Links

HGNC: 10860

OMIM: 109675

KEGG: hsa:6480

STRING: 9606.ENSP00000169298

UniGene: Hs.207459

Protein Families
Glycosyltransferase 29 family
Subcellular Location
Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Secreted. Note=Membrane-bound form in trans cisternae of Golgi. Secreted into the body fluid.

Q&A

What is the primary function of ST6GAL1?

ST6GAL1 is a Golgi-resident sialyltransferase that catalyzes the addition of α2,6-linked sialic acids to the terminal galactose of N-glycosylated proteins. Specifically, it generates α2,6 linkages of sialic acid on the non-reducing, terminal Galβ1-4GlcNAc residues of oligosaccharides and glycoconjugates . This sialylation modification affects glycoprotein structure and function, influencing numerous biological processes including cell-cell recognition, immune function, and receptor signaling.

How does ST6GAL1 differ from ST6GAL2?

While both enzymes are beta-galactoside alpha-2,6-sialyltransferases with 48.9% amino acid sequence identity, they differ significantly in expression patterns and substrate specificity:

CharacteristicST6GAL1ST6GAL2
Tissue expressionBroadly expressed in most tissues, with highest levels in liverRestricted tissue-specific pattern, mostly in embryonic and adult brain
Substrate specificityBroad specificity for glycoproteins and glycolipidsPrimarily catalyzes 2,6-sialylation of non-reducing end Galβ1-4GlcNAc disaccharide on oligosaccharides; low activity toward glycoproteins and glycolipids
Physiological roleWell-characterized in immune function, cancer progressionLess well understood

ST6GAL1 has relatively broad substrate specificity, while ST6GAL2 shows more restricted activity and is primarily expressed in neural tissues .

How is ST6GAL1 expression altered in cancer?

ST6GAL1 is overexpressed in numerous cancer types, including breast, cervical, ovarian, prostate, pancreatic, colon, gastric, leukemia, hepatocellular carcinoma, and melanoma . This elevation is often attributed to gene amplification . In prostate cancer specifically, ST6GAL1 is significantly upregulated in cancer tissue compared to matched normal tissue, as verified in 200 patient samples .

What oncogenic signaling pathways are affected by ST6GAL1?

ST6GAL1 influences several key oncogenic pathways:

  • PI3K/AKT pathway: ST6GAL1 enhances PI3K/AKT signaling in multiple cancer types, including colon, liver, ovarian, and breast cancers . This activation promotes invasion, proliferation, and epithelial-to-mesenchymal transition (EMT).

  • EGFR signaling: ST6GAL1-mediated sialylation of EGFR has been linked to activation of PI3K/AKT signaling, increasing invasion and proliferation .

  • TGF-β pathway: ST6GAL1 transcription and α2,6-sialylated N-glycans are upregulated during TGF-β-induced EMT, requiring the Sp1 element within the ST6GAL1 promoter .

How does ST6GAL1 contribute to chemoresistance in cancer?

Research has demonstrated that ST6GAL1 contributes to chemoresistance through multiple mechanisms:

  • Cisplatin resistance: Cells that are resistant to cisplatin have upregulated endogenous ST6GAL1. Studies with ovarian cancer cell lines showed that cisplatin-resistant populations exhibited higher levels of ST6GAL1 compared to parental cells .

  • Radiation resistance: ST6GAL1 has been shown to confer radiation resistance in colon cancer cell lines .

  • Multidrug resistance: ST6GAL1 expression is associated with multidrug resistance in human acute myeloid leukemia .

The mechanisms likely involve ST6GAL1-mediated sialylation of specific receptors that influence survival signaling pathways.

How can recombinant ST6GAL1 be used in in vitro glycoengineering?

Recombinant ST6GAL1 can be used as a glycoengineering tool to modify glycoproteins in vitro . This has particular relevance for:

  • Antibody engineering: Recombinant ST6GAL1 can be used to add α2,6-sialic acids to the Fc N-glycan of antibodies, which provides anti-inflammatory properties through a mechanism that remains under investigation .

  • Studying structure-function relationships: By selectively modifying glycans on specific proteins, researchers can investigate how α2,6-sialylation affects protein function.

  • Developing therapeutic glycoproteins: Controlled sialylation can optimize pharmacokinetic properties of therapeutic proteins.

The process typically involves incubating the target glycoprotein with recombinant ST6GAL1 and the donor substrate CMP-N-acetylneuraminate (CMP-sialic acid) under appropriate buffer conditions.

What are the optimal conditions for using recombinant ST6GAL1 in experimental settings?

Effective use of recombinant ST6GAL1 requires optimization of several parameters:

ParameterRecommendationNotes
pH6.5-7.0Activity can vary significantly with pH
Temperature30-37°CLower temperatures may preserve enzyme stability for longer reactions
CMP-sialic acid concentration0.5-1 mMDonor substrate concentration affects reaction efficiency
Acceptor concentrationVariableDepends on the specific glycoprotein substrate
Divalent cations10-20 mM Mn²⁺Often enhances activity
Incubation time1-24 hoursDepends on the desired degree of sialylation

Additionally, for efficient Fc glycan α2,6-sialylation of IgG1, co-expression with both human α2,6-sialyltransferase 1 (ST6) and β1,4-galactosyltransferase 1 (GT) in CHO cells has been shown to be effective. Optimal plasmid ratios were determined to be 2% GT encoding plasmid and 20% ST6 encoding plasmid in the transfection mix .

How can the success of ST6GAL1-mediated sialylation be assessed?

Several complementary techniques can be used to confirm successful α2,6-sialylation:

  • Lectin blotting: The Sambucus nigra lectin (SNA) specifically detects α2,6-sialylation, while Maackia amurensis lectin II (MALII) detects α2,3-sialylation .

  • Mass spectrometry: LC-ESI-MS can be used to analyze Fc glycans and determine the extent of sialylation .

  • Capillary zone electrophoresis isoelectric focusing (cIEF): This technique can assess the nature of sialic acid linkage following sequential sialidase digestions .

  • Hydrophilic interaction liquid chromatography (HILIC): Provides detailed analysis of glycan structures .

How does extracellular ST6GAL1 differ from intracellular ST6GAL1 in function?

While canonically ST6GAL1 resides in the intracellular secretory apparatus and glycosylates nascent glycoproteins in biosynthetic transit, catalytically active ST6GAL1 is also released into the extracellular milieu. Research indicates that:

  • Extracellular ST6GAL1 can extracellularly remodel cell surface and secreted glycans, representing a non-canonical mechanism of glycan modification .

  • Extracellular ST6GAL1 from remote sources (such as the liver) can compensate for cellular ST6GAL1-mediated functions, including aggressive tumor cell proliferation and invasive behavior .

  • Extracellular ST6GAL1 has been identified as a potent modifier of hematopoiesis, inflammatory cell production, B cell differentiation and proliferation, and in the sialylation of anti-inflammatory IgG .

These findings challenge traditional views of glycosylation as exclusively an intracellular process and suggest systemic glycan remodeling as a novel regulatory mechanism.

What structural elements of ST6GAL1 determine its substrate specificity?

Research on the structural determinants of ST6GAL1 substrate recognition has revealed:

  • The N-terminal half of the polypeptide influences acceptor preference. Deletion of the transmembrane fragment induces loss of acceptor preference for specific glycoproteins .

  • A peptide region of approximately 50 amino acids within the ST6GAL1 stem region governs both the preference for glycoprotein acceptors and catalytic activity, suggesting it exerts steric control on the catalytic domain .

  • Progressive truncation of the N-terminus demonstrates that the catalytic domain can proceed with sialic acid transfer with increased efficiency until 80 amino acids are deleted .

  • When the ST6GAL1 catalytic domain is fused to the N-terminal half of an unrelated transferase (core 2 β1,6-N-acetylglucosaminyltransferase), a chimeric form with broad acceptor specificity and high activity can be engineered .

These findings contribute to understanding how ST6GAL1 recognizes and selects its glycoprotein substrates, which has implications for both basic research and biotechnological applications.

How does ST6GAL1-mediated sialylation affect specific receptor functions in cancer?

ST6GAL1 has been shown to modify several receptors critical to cancer progression:

  • EGFR: ST6GAL1-mediated sialylation of EGFR enhances PI3K/AKT signaling, promoting invasion and proliferation in various cancers .

  • E-cadherin: Overexpression of ST6GAL1 increases the turnover of cell surface E-cadherin and promotes TGF-β-induced EMT, while knockdown of ST6GAL1 strongly suppresses TGF-β-induced EMT with a concomitant increase in E-cadherin expression .

  • Fcγ receptors: Terminal sialylation has been shown to decrease Fcγ receptor binding, affecting immune recognition of cancer cells .

These modifications alter receptor stability, trafficking, dimerization, and downstream signaling, ultimately contributing to cancer hallmarks such as sustained proliferation, enhanced self-renewal, EMT, invasion, and chemoresistance .

What are the most effective approaches for manipulating ST6GAL1 expression in experimental systems?

Researchers have successfully employed several strategies to modulate ST6GAL1 levels:

  • Genetic approaches:

    • shRNA knockdown: Stable transduction with lentivirus expressing shRNA for ST6GAL1 has been effective in reducing endogenous ST6GAL1 in cancer cell lines .

    • Overexpression: Transient co-expression with other glycosyltransferases (e.g., GT) has been used to enhance specific glycan modifications .

  • Pharmacological approaches:

    • Sialyltransferase inhibitors: The sialyltransferase inhibitor P-3F AX-Neu5Ac has been used to target α2,6 sialylated N-glycans expressed by prostate cancer cells .

  • Expression system considerations:

    • No significant differences in substrate recognition have been observed when soluble forms of ST6GAL1 with similar peptide sequences were produced in either yeast or mammalian cells, confirming that heterologous expression does not alter enzyme folding and activity .

How can researchers analyze ST6GAL1 expression and activity in tissue samples?

Multiple complementary techniques are recommended for comprehensive analysis:

  • Expression analysis:

    • Immunohistochemistry: Using ST6GAL1-specific antibodies has revealed differential expression patterns in normal versus cancer tissues. For example, in normal and cirrhotic liver, ST6GAL1 was localized in the Golgi region of hepatocytes surrounding the bile canaliculi, while HCC showed Golgi and diffuse cytoplasmic staining .

    • Western blotting: Can detect ST6GAL1 protein levels, typically appearing at approximately 64 kDa under reducing conditions .

    • qRT-PCR: For quantitative analysis of ST6GAL1 mRNA expression.

  • Activity and glycan analysis:

    • MALDI imaging mass spectrometry (MALDI-IMS): Has been used to identify larger branched α2,6 sialylated N-glycans that show specificity to prostate tumor tissue .

    • Lectin blotting: Using SNA (Sambucus nigra lectin) to detect α2,6-sialylated glycans and MALII (Maackia amurensis lectin II) to detect α2,3-sialylated glycans .

    • Flow cytometry: Using recombinant fusion proteins of CD22 and sialoadhesin that recognize α2,6- or α2,3-sialylated glycans .

What are the key considerations when using recombinant ST6GAL1 for in vitro sialylation studies?

Researchers should consider several factors to optimize in vitro sialylation experiments:

  • Enzyme form selection:

    • Full-length versus truncated: Differences in transfer efficiency have been observed between membrane and soluble enzymatic forms, with deletion of the transmembrane fragment inducing loss of acceptor preference .

    • Expression system: No significant differences in enzyme activity have been observed between soluble ST6GAL1 produced in yeast versus mammalian cells .

  • Reaction optimization:

    • Substrate concentration: For antibody sialylation, an optimal DNA mix composition of 2% GT plasmid and 20% ST6 plasmid has been determined for efficient Fc glycan sialylation .

    • Reaction conditions: Buffer composition, pH, temperature, and incubation time need optimization for specific applications.

  • Confirmation methods:

    • Multiple complementary analytical techniques should be employed to confirm successful sialylation, including mass spectrometry, lectin blotting, and electrophoresis-based methods .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.