Recombinant Human Bifunctional apoptosis regulator (BFAR)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Mechanisms

BFAR exhibits anti-apoptotic activity by modulating mitochondrial and death receptor pathways. Its multidomain architecture enables diverse interactions:

Anti-Apoptotic Activity

  • Mitochondrial Pathway Inhibition: BFAR interacts with Bcl-2/Bcl-XL via its SAM domain, sequestering pro-apoptotic factors like Bax .

  • Death Receptor Pathway Regulation: Contains pseudo death effector domains (DEDs) that bind Caspase-8, blocking its activation .

  • ER Stress Modulation: Localizes to the endoplasmic reticulum (ER), protecting neurons from ER stress-induced apoptosis .

DomainFunctionInteractionsCitations
RING DomainE3 ubiquitin ligase activityUbiquitin transfer
SAM DomainDimerization/interaction with Bcl-2 family proteinsBcl-XL, Bcl-2
Pseudo DEDsCaspase-8 bindingCaspase-8 subunits

Emerging Research Findings

Recent studies highlight BFAR’s role in TGFβ signaling and lipid metabolism:

TGFβ Signaling and Th9 Cell Differentiation

BFAR acts as an E3 ligase, mediating K63-linked ubiquitination of TGFβR1 at lysine 268 (K268), which is essential for TGFβ-driven Th9 cell activation :

  • Mechanism: BFAR promotes TGFβR1 ubiquitination, enhancing Smad2/3 signaling and IL-9 production.

  • Therapeutic Implications: Overexpression of BFAR in Th9 cells enhances tumor suppression and anti-PD-1 therapy efficacy in colorectal cancer models .

Regulation of PNPLA3 and Fatty Liver Disease

BFAR targets PNPLA3 (patatin-like phospholipase domain-containing protein 3) for degradation, reducing lipid droplet accumulation in hepatocytes :

  • Mechanism: BFAR-mediated ubiquitination of PNPLA3 leads to its proteasomal/autophagosomal degradation.

  • Clinical Relevance: Bfar−/− mice show elevated PNPLA3 levels, linking BFAR to fatty liver disease (FLD) pathogenesis .

Research Applications

Recombinant BFAR is utilized in:

  1. Apoptosis Studies: Examining ER stress, mitochondrial dysfunction, and death receptor pathways .

  2. Immunotherapy: Investigating Th9 cell differentiation for cancer treatment .

  3. Metabolic Disorders: Studying PNPLA3 degradation in FLD models .

Comparative Analysis of BFAR’s E3 Ligase Activity

SubstrateModificationBiological ImpactCitations
TGFβR1K63-linked ubiquitinationEnhanced Th9 differentiation
PNPLA3PolyubiquitinationReduced lipid droplet formation
BI-1Ubiquitination (reported)ER stress modulation (context-dependent)

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate your specific requirements. Please indicate your preferred format in your order notes and we will fulfill your request whenever possible.
Lead Time
Delivery times may vary based on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Avoid repeated freezing and thawing. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can serve as a reference for your preparation.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Minimize repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during the production process. If you have a specific tag preference, please inform us and we will prioritize fulfilling your request.
Synonyms
BFAR; BAR; RNF47; Bifunctional apoptosis regulator; RING finger protein 47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-450
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
BFAR
Target Protein Sequence
MEEPQKSYVNTMDLERDEPLKSTGPQISVSEFSCHCCYDILVNPTTLNCGHSFCRHCLAL WWASSKKTECPECREKWEGFPKVSILLRDAIEKLFPDAIRLRFEDIQQNNDIVQSLAAFQ KYGNDQIPLAPNTGRANQQMGGGFFSGVLTALTGVAVVLLVYHWSSRESEHDLLVHKAVA KWTAEEVVLWLEQLGPWASLYRERFLSERVNGRLLLTLTEEEFSKTPYTIENSSHRRAIL MELERVKALGVKPPQNLWEYKAVNPGRSLFLLYALKSSPRLSLLYLYLFDYTDTFLPFIH TICPLQEDSSGEDIVTKLLDLKEPTWKQWREFLVKYSFLPYQLIAEFAWDWLEVHYWTSR FLIINAMLLSVLELFSFWRIWSRSELKTVPQRMWSHFWKVSTQGLFVAMFWPLIPQFVCN CLFYWALYFNPIINIDLVVKELRRLETQVL
Uniprot No.

Target Background

Function
Bifunctional apoptosis regulator (BFAR) is an apoptosis regulator with anti-apoptotic activity. It exhibits protective effects against apoptosis triggered via death-receptors and mitochondrial pathways.
Gene References Into Functions
  1. Data indicate that p75NTR and BFAR co-localize within the cytoplasm. PMID: 22566094
  2. Post-translational regulation of the BI-1 protein by E3 ligase BAR contributes to the dynamic control of IRE1 signaling during endoplasmic reticulum stress. PMID: 21068390
  3. Overexpression of BFAR Delta RING enhances the heart's resistance to I/R injury and DOX-induced cardiotoxicity. This protective effect is linked to a reduction in cardiomyocyte apoptosis. PMID: 18805781
Database Links

HGNC: 17613

KEGG: hsa:51283

STRING: 9606.ENSP00000261658

UniGene: Hs.435556

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed highly in brain, moderately in small intestine, weakly in testes and only faintly in liver and skeletal muscle. Not expressed in heart, kidney, lung and spleen.

Q&A

What is the basic structure and cellular localization of human BFAR?

Human BFAR (Bifunctional apoptosis regulator) is a membrane-bound E3 ubiquitin ligase, also known as BAR or RNF47, with Uniprot ID Q9NZS9. The protein contains distinct functional domains, including a RING domain that is critical for its E3 ligase activity. Research demonstrates that deletion of the ring domain (BFARΔR) abolishes its ability to mediate K63-linked ubiquitination of target proteins . BFAR is primarily localized to cellular membranes where it can interact with both death receptor pathways and mitochondrial apoptotic machinery, consistent with its bifunctional nature .

Methodologically, researchers can study BFAR localization using subcellular fractionation followed by western blotting or immunofluorescence microscopy with specific anti-BFAR antibodies. For structural analysis, recombinant expression systems can be employed, such as the E. coli-based expression system used to produce the human BFAR (NP_057645.1) 1-331 amino acid sequence with a polyhistidine tag for purification and functional studies .

What are the primary anti-apoptotic mechanisms of BFAR?

BFAR demonstrates dual anti-apoptotic activity by inhibiting both death receptor-mediated and mitochondrial factor-triggered apoptotic pathways . This bifunctional capacity makes it unique among apoptosis regulators. The protein appears to achieve this through multiple protein-protein interactions and post-translational modifications of target proteins.

Experimentally, researchers can investigate these mechanisms by:

  • Performing co-immunoprecipitation studies to identify BFAR binding partners

  • Conducting cell viability assays in BFAR-overexpressing or BFAR-depleted cells exposed to apoptotic stimuli

  • Measuring activation of downstream apoptotic markers (caspases, PARP cleavage) with and without BFAR modulation

  • Using domain-specific mutants to determine which regions of BFAR are necessary for each anti-apoptotic function

How does BFAR function as an E3 ubiquitin ligase?

BFAR functions as an E3 ubiquitin ligase specifically mediating K63-linked ubiquitination of target proteins such as TGFβR1 . Unlike K48-linked ubiquitination that typically targets proteins for proteasomal degradation, K63-linked ubiquitination often modifies protein function or trafficking. The RING domain of BFAR is essential for this activity, as demonstrated by experiments showing that RING domain-deleted mutants (BFARΔR) cannot mediate ubiquitination .

For methodological approaches to study BFAR's E3 ligase activity, researchers can:

  • Perform in vitro ubiquitination assays using purified recombinant BFAR, E1, E2 enzymes, ubiquitin, and potential substrate proteins

  • Analyze ubiquitination patterns in cells with overexpressed or knocked-out BFAR using ubiquitin linkage-specific antibodies

  • Conduct mass spectrometry analysis to identify ubiquitination sites on target proteins

  • Use site-directed mutagenesis to generate BFAR variants with altered E3 ligase activity for functional studies

How does BFAR modulate TGFβ signaling in T helper 9 (Th9) cell differentiation?

BFAR plays a critical role in regulating TGFβ signaling during Th9 cell differentiation by mediating K63-linked ubiquitination of TGFβR1. Research has shown that BFAR and TGFβR1 physically associate in CD4+ T cells, and this interaction is enhanced upon T cell receptor (TCR) stimulation . The E3 ligase activity of BFAR specifically promotes K63-linked ubiquitination of TGFβR1, but not other linkage types (K6, K9, K11, K27, K33, or K48) .

The functional consequences of this interaction include:

  • BFAR deficiency abolishes TCR-induced TGFβR1 ubiquitination in primary CD4+ T cells

  • Under Th9 differentiation conditions, BFAR overexpression dramatically promotes endogenous K63-linked ubiquitination of TGFβR1

  • BFAR deletion sharply inhibits endogenous K63-linked ubiquitination of TGFβR1

These modifications appear critical for downstream TGFβ signaling required for Th9 differentiation, as BFAR-deficient or K268R knock-in mutation suppresses both TGFβR1 ubiquitination and Th9 differentiation .

What is the role of BFAR in cancer immunotherapy?

Research has revealed a promising therapeutic potential for BFAR in cancer immunotherapy through its regulation of Th9 cell differentiation. Th9 cells exhibit anti-tumor properties, and BFAR appears to be a key regulator of their development and function. Specifically:

  • BFAR-overexpressing Th9 cells demonstrate enhanced therapeutic efficacy in curtailing tumor growth and metastasis

  • BFAR-enhanced Th9 cells promote sensitivity to anti-PD-1-mediated checkpoint immunotherapy

  • Conversely, BFAR deficiency inhibits Th9-mediated cancer immunotherapy

These findings establish BFAR as a TGFβ-regulated gene that fine-tunes TGFβ signaling affecting Th9 induction sensitivity. The translational potential of targeting BFAR to promote Th9-mediated cancer immunotherapy represents an exciting avenue for future research and therapeutic development.

For experimental investigation of BFAR in cancer immunotherapy, researchers should consider:

  • Generating conditional knockout models to specifically delete BFAR in T cells

  • Assessing tumor growth and metastasis in models with BFAR-overexpressing Th9 cells versus controls

  • Combining BFAR modulation with established checkpoint inhibitors to evaluate synergistic effects

  • Analyzing immune infiltration and cytokine profiles in tumors treated with BFAR-modified T cells

How does BFAR contribute to fatty liver disease through PNPLA3 regulation?

BFAR has been identified as a key regulator of PNPLA3 (patatin-like phospholipase domain-containing protein 3) levels in hepatocytes. The PNPLA3(I148M) variant is the most significant genetic risk factor for fatty liver disease (FLD). Research demonstrates that BFAR promotes the ubiquitylation and subsequent degradation of PNPLA3 through both proteasomal and autophagosomal pathways .

Key experimental findings supporting this role include:

  • siRNA-mediated inactivation of BFAR increases PNPLA3 levels in cultured hepatocytes

  • Overexpression of BFAR decreases levels of endogenous PNPLA3 in HuH7 cells

  • BFAR and PNPLA3 co-immunoprecipitate when co-expressed, indicating a physical interaction

  • In a reconstitution assay using purified recombinant proteins, BFAR promotes PNPLA3 ubiquitylation in vitro

  • Genetic inactivation of Bfar in mice results in a twofold increase in PNPLA3 protein levels in hepatic lipid droplets, without corresponding changes in PNPLA3 mRNA levels

These findings suggest BFAR is a potential therapeutic target for enhancing PNPLA3 turnover to prevent fatty liver disease. The fact that BFAR's effect on PNPLA3 appears to be post-translational is particularly significant, as it provides a potential mechanism to regulate the pathogenic PNPLA3(148M) variant that accumulates on lipid droplets.

What are the optimal systems for recombinant BFAR expression and purification?

For research requiring recombinant human BFAR protein, E. coli expression systems have been successfully employed. According to available information, a DNA sequence encoding human BFAR (NP_057645.1) amino acids 1-331 has been expressed with a polyhistidine tag for purification purposes . This approach allows for the production of functional protein for biochemical and structural studies.

When designing expression systems for BFAR, researchers should consider:

  • Domain organization: Including specific functional domains (such as the RING domain) critical for the intended experimental applications

  • Purification strategy: Using affinity tags (His-tag, as reported) that can be removed if necessary for downstream applications

  • Protein solubility: Optimizing expression conditions to prevent aggregation of this membrane-associated protein

  • Functional validation: Confirming E3 ligase activity of purified BFAR using in vitro ubiquitination assays

Table 1: Recommended parameters for recombinant BFAR expression in E. coli

ParameterRecommended ConditionNotes
Expression systemE. coli BL21(DE3)Standard strain for recombinant protein expression
Expression vectorpET-based with His-tagAllows IPTG induction and affinity purification
Induction0.5 mM IPTG, 18°C, 16hLower temperature may improve solubility
Lysis bufferPBS with 1% Triton X-100Detergent helps solubilize membrane-associated proteins
PurificationNi-NTA affinity chromatographyStandard for His-tagged proteins
Quality controlSDS-PAGE and Western blotConfirm size and identity
Activity assayIn vitro ubiquitinationVerify E3 ligase functionality

What genetic models are available to study BFAR function in vivo?

Several genetic models have been developed to study BFAR function in vivo, as evidenced by the research literature:

  • Conditional knockout (KO) mice with specific deletion of BFAR in T cells have been generated to study BFAR's role in T cell signaling and Th9 differentiation

  • Complete Bfar knockout mice (Bfar^-/-) have been used to investigate BFAR's role in PNPLA3 regulation and fatty liver disease

  • BFAR K268R knock-in mutation models have been employed to study the effects of specific post-translational modifications on BFAR function in Th9 differentiation

When designing experiments with these models, researchers should consider:

  • Cell-type specificity of BFAR expression and function

  • Potential developmental compensation in constitutive knockout models

  • The need for appropriate controls (littermates, wild-type cells with comparable genetic background)

  • Phenotypic characterization across multiple systems given BFAR's involvement in both immune and metabolic processes

How can researchers study BFAR-mediated ubiquitination of target proteins?

Studying BFAR-mediated ubiquitination requires specific techniques to detect and characterize ubiquitin chains. Based on the research literature, the following methodological approaches are recommended:

  • In vitro ubiquitination assays: Using purified recombinant BFAR, E1 activating enzyme, E2 conjugating enzyme, ubiquitin, ATP, and the target substrate (e.g., TGFβR1 or PNPLA3) to demonstrate direct ubiquitination activity

  • Cell-based ubiquitination assays:

    • Transfection of cells with tagged BFAR and substrate proteins

    • Immunoprecipitation under denaturing conditions to isolate substrate proteins

    • Western blotting with ubiquitin linkage-specific antibodies (particularly K63-specific antibodies for BFAR targets)

  • Analysis of ubiquitin chain topology:

    • Using ubiquitin mutants with specific lysine residues mutated (K6R, K11R, K27R, K29R, K33R, K48R, K63R) to determine which lysine residues are used for chain formation

    • Mass spectrometry analysis to identify ubiquitination sites on substrate proteins

  • Functional consequences of ubiquitination:

    • Site-directed mutagenesis of potential ubiquitination sites on target proteins

    • Analysis of substrate protein stability, localization, or activity with and without BFAR expression

These approaches have successfully demonstrated that BFAR specifically mediates K63-linked ubiquitination of TGFβR1, which is critical for downstream signaling in Th9 differentiation .

How do researchers reconcile BFAR's dual roles in apoptosis regulation and protein degradation?

One of the challenges in BFAR research is reconciling its seemingly distinct functions as both an apoptosis regulator and an E3 ubiquitin ligase involved in protein degradation. Available data suggests several possible interpretations:

  • Integrated signaling model: BFAR may coordinate cellular decisions about survival and protein homeostasis through its dual functions, potentially serving as a regulatory node where apoptotic and protein degradation pathways intersect.

  • Context-dependent functionality: BFAR's primary function may vary by cell type and physiological context, with its anti-apoptotic activity predominating in some contexts and its E3 ligase activity in others.

  • Mechanistic connection: BFAR's anti-apoptotic function may directly depend on its ability to ubiquitinate specific pro-apoptotic proteins, targeting them for degradation or altering their function through K63-linked ubiquitination.

  • Evolutionary adaptation: The bifunctional nature of BFAR may represent an evolutionary adaptation that allows for coordinated regulation of multiple cellular processes through a single protein.

To address this research challenge, investigators should consider:

  • Conducting proteome-wide analyses to identify the complete set of BFAR substrates

  • Performing domain-specific mutation studies to separate BFAR's different functions

  • Using systems biology approaches to map BFAR's position in cellular signaling networks

  • Examining BFAR function across different cell types and physiological/pathological conditions

What are the apparent contradictions in BFAR's roles in different disease contexts?

BFAR appears to play contrasting roles in different disease contexts, which presents an interpretive challenge for researchers. For example:

  • In cancer immunotherapy: BFAR overexpression in Th9 cells enhances anti-tumor immunity, suggesting a potential tumor-suppressive role through immune modulation .

  • In apoptosis regulation: BFAR's anti-apoptotic activity might theoretically promote cancer cell survival, suggesting a potential tumor-promoting role .

  • In fatty liver disease: BFAR promotes degradation of PNPLA3, including the disease-associated I148M variant, suggesting a protective role against metabolic disorders .

These seemingly contradictory functions highlight the context-dependent nature of BFAR activity and the importance of studying this protein in specific cellular and disease contexts. Researchers should consider:

  • The cell-type specificity of BFAR function (immune cells vs. hepatocytes vs. cancer cells)

  • The molecular targets of BFAR in each context (TGFβR1 vs. PNPLA3 vs. apoptotic regulators)

  • The signaling pathways modified by BFAR-mediated ubiquitination in each scenario

  • The potential for therapeutic targeting of BFAR that might benefit one condition while exacerbating another

How might targeting BFAR enhance cancer immunotherapy?

Based on research findings, BFAR modulation represents a promising approach to enhance cancer immunotherapy by promoting Th9 cell-mediated anti-tumor immunity. The evidence suggests several potential translational strategies:

  • BFAR-overexpressing Th9 cells: Engineering T cells to overexpress BFAR could enhance their anti-tumor properties, as BFAR-overexpressing Th9 cells have demonstrated promising therapeutic efficacy in curtailing tumor growth and metastasis .

  • Combination therapies: BFAR-modulated Th9 cells show enhanced sensitivity to anti-PD-1-mediated checkpoint immunotherapy, suggesting potential synergistic effects when combined with established checkpoint inhibitors .

  • Small molecule activators: Developing compounds that enhance BFAR's E3 ligase activity specifically toward TGFβR1 could potentially boost endogenous Th9 differentiation and function.

Methodologically, researchers pursuing this direction should:

  • Establish robust protocols for generating and expanding BFAR-overexpressing Th9 cells

  • Conduct comprehensive preclinical studies in multiple tumor models

  • Investigate potential off-target effects given BFAR's multiple cellular functions

  • Develop biomarkers to identify patients most likely to benefit from BFAR-targeted therapies

What is the therapeutic potential of targeting BFAR in fatty liver disease?

BFAR has emerged as a potential therapeutic target for fatty liver disease based on its role in promoting the degradation of PNPLA3, particularly the disease-associated I148M variant. Research indicates several promising approaches:

  • BFAR activation: Enhancing BFAR expression or activity could increase PNPLA3 turnover, potentially preventing accumulation of the I148M variant on lipid droplets .

  • Pathway modulation: Targeting specific components of the BFAR-mediated degradation pathway might enhance PNPLA3 clearance from hepatic lipid droplets.

  • Combination approaches: Combining BFAR modulation with other fatty liver disease treatments might provide synergistic benefits.

Key considerations for researchers in this area include:

  • Developing hepatocyte-specific BFAR modulation to avoid systemic effects

  • Investigating potential compensatory mechanisms that might limit therapeutic efficacy

  • Addressing the potential impact on other BFAR substrates beyond PNPLA3

  • Determining whether BFAR modulation is effective in the context of established fatty liver disease or primarily as a preventative approach

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.