Recombinant Human Blood vessel epicardial substance (BVES)

Shipped with Ice Packs
In Stock

Description

Introduction

Blood vessel epicardial substance (BVES), also known as POPDC1 (Popeye Domain Containing 1), is a protein associated with tight junctions and was initially identified through a cDNA screen of the developing heart . BVES is not only present in cardiac and skeletal tissue but also in the gastrointestinal epithelium . Research indicates that BVES plays a crucial role in maintaining epithelial phenotypes and suppressing tumorigenesis .

BVES Function and Molecular Pathways

BVES regulates several molecular pathways, including cAMP, WNT, and the degradation of the oncogene c-Myc .

One study identified a high-affinity cAMP binding domain within the POPEYE domain of BVES. Biochemical experiments demonstrated that BVES directly binds to cAMP, and mutating specific amino acids (D200, E203, and V217) modulated the affinity of this interaction . Additionally, BVES interacts with the 2-pore domain potassium channel TREK-1, with this interaction being sensitive to cAMP stimulation . It has been suggested that BVES recruits TREK-1 to the membrane to enhance current, a process modulated by cAMP levels .

BVES and Vesicular Transport

BVES is linked to vesicular transport, a fundamental cellular process . Disruption of BVES and VAMP3 results in similar phenotypes, supporting the hypothesis that intact BVES function is required for proper VAMP3-mediated recycling of different molecules .

Integrin Internalization in MDCK Cells

MDCKBves118
% Positive59.6±535.5±5
Total cells19552597
P-value<0.0001
mut-TeNTBves118
% Positive62.4±1637.8±7
Total cells733768
P-value (mut-TeNT)<0.004
P-value (Bves118)

BVES and Disease

Mice lacking BVES exhibit worse intestinal injury and inflammation . BVES is suppressed in gastrointestinal cancers, and its loss promotes tumor formation in mouse models .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BVES; POP1; POPDC1; Blood vessel epicardial substance; hBVES; Popeye domain-containing protein 1; Popeye protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
BVES
Target Protein Sequence
MNYTESSPLRESTAIGFTPELESIIPVPSNKTTCENWREIHHLVFHVANICFAVGLVIPT TLHLHMIFLRGMLTLGCTLYIVWATLYRCALDIMIWNSVFLGVNILHLSYLLYKKRPVKI EKELSGMYRRLFEPLRVPPDLFRRLTGQFCMIQTLKKGQTYAAEDKTSVDDRLSILLKGK MKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIIADDNCRFLCWSRERLTYFLE SEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSS DSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP
Uniprot No.

Target Background

Function
Blood Vessel Epicardial Substance (BVES) is a cell adhesion molecule crucial for maintaining cell integrity. It contributes to the formation and regulation of tight junctions (TJs) and the paracellular permeability barrier in epithelial cells. BVES plays a role in VAMP3-mediated vesicular transport and receptor recycling via its interaction with VAMP3. Furthermore, it regulates cell shape and movement by modulating Rho-family GTPase activity through interaction with ARHGEF25/GEFT. BVES induces initial cell adhesion and aggregation in a calcium-independent manner. Its functions extend to striated muscle regeneration, cell spreading regulation, and the maintenance of cardiac function. It modulates heart rate dynamics, potentially through cAMP binding and by increasing the cell surface expression of the potassium channel KCNK2, enhancing current density. BVES is also a caveolae-associated protein essential for maintaining caveolae structural and functional integrity and protecting the heart from ischemic injury.
Gene References Into Functions
  • Functional suppression of POPDC1 promoted breast cancer cell migration and proliferation; cAMP interacts with POPDC1 and upregulates its expression in breast cancer cells. PMID: 28954821
  • The Popeye domain containing (POPDC) family, comprising POPDC1, POPDC2, and POPDC3, are transmembrane proteins abundant in striated and smooth muscle cells. POPDC proteins exhibit high-affinity cAMP binding comparable to PKA. PMID: 28939104
  • EGFR negatively regulates POPDC1 expression in breast cancer cell lines; POPDC1 overexpression reduces EGFR-mediated cell migration and proliferation. PMID: 28807821
  • BVES maintains colonic mucosa integrity and protects against inflammatory carcinogenesis, promoting c-Myc post-translational degradation. PMID: 28389570
  • POPDC1(S201F) overexpression in HL-1 cells increased action potential hyperpolarization and upstroke velocity. PMID: 26642364
  • BVES downregulation in hepatocellular carcinoma induces epithelial-mesenchymal transition, promoting invasion and metastasis. PMID: 24442236
  • Four novel BVES mutations were identified in Tetralogy of Fallot patients but not in controls. PMID: 23403794
  • Popdc1 (Bves) modulates cardiac pacemaker activity in response to stress and is highly expressed in the sinus node. The Popeye domain binds cAMP, and Popdc proteins interact with TREK-1. PMID: 22354168
  • Low Bves expression correlates with gastric cancer progression. PMID: 22109561
  • BVES underexpression is observed in all stages of colorectal carcinoma and adenomatous polyps, suggesting early suppression during transformation. PMID: 21911938
  • Bves expression and localization regulate RhoA and ZONAB/DbpA activity. PMID: 21283798
  • POPDC gene expression is altered in end-stage heart failure, suggesting regulatory and functional differences between family members, with POPDC1 being particularly affected. PMID: 21069264
  • Frequent BVES silencing is associated with promoter hypermethylation in gastric cancer. PMID: 20627872
  • BVES methylation is present in 80% of NSCLC tissues but only 14% of noncancerous tissues. PMID: 18349282
Database Links

HGNC: 1152

OMIM: 604577

KEGG: hsa:11149

STRING: 9606.ENSP00000313172

UniGene: Hs.221660

Involvement In Disease
Limb-girdle muscular dystrophy 2X (LGMD2X)
Protein Families
Popeye family
Subcellular Location
Lateral cell membrane. Cell junction, tight junction. Membrane; Multi-pass membrane protein. Cell membrane, sarcolemma. Membrane, caveola.
Tissue Specificity
Expressed in epithelial cells (at protein level). Expressed in fetal and adult heart and skeletal muscle.

Q&A

What is Blood Vessel Epicardial Substance (BVES) and what are its alternative nomenclatures?

Blood Vessel Epicardial Substance (BVES) is a tight-junction associated protein that was originally discovered from a cDNA screen of the developing heart. It belongs to the Popeye domain-containing (POPDC) family of proteins, which contain a characteristic Popeye domain in their extracellular region. BVES is also known as POPDC1 or POPEYE in the scientific literature, with all these names referring to the same protein . The protein plays critical roles in maintaining epithelial integrity and regulating several molecular pathways. While initially identified in cardiac tissue, subsequent research has demonstrated its expression and function in multiple tissues throughout the body, particularly in epithelial barriers.

What cellular and molecular functions has BVES been shown to regulate?

BVES has been demonstrated to regulate several critical molecular pathways and cellular functions:

  • Tight junction regulation: BVES is associated with tight junctions and helps maintain epithelial barrier integrity.

  • cAMP signaling pathway: BVES modulates cAMP-dependent signaling, which affects various cellular processes.

  • WNT pathway regulation: Research shows BVES can influence the WNT signaling cascade, which is central to development and disease.

  • c-Myc degradation: BVES promotes the degradation of the oncogene c-Myc, suggesting a tumor suppressor function.

  • Epithelial phenotype maintenance: BVES helps preserve epithelial cell characteristics and prevents epithelial-to-mesenchymal transition .

These regulatory functions explain why BVES disruption can lead to pathological conditions ranging from inflammatory disorders to cancer development.

In which tissues is BVES naturally expressed, and what are the implications for recombinant protein studies?

Research over the past decade has established that BVES expression extends beyond its initially discovered cardiac context. BVES is expressed in:

  • Cardiac tissue and myocardium

  • Skeletal muscle tissue

  • Throughout the gastrointestinal epithelium

  • Other epithelial barriers in the body

This broad expression pattern has important implications for recombinant human BVES studies. Researchers must consider tissue-specific post-translational modifications and protein-protein interactions when producing and studying recombinant forms of the protein. Additionally, functional assays should be designed with awareness of tissue-specific roles that may require different experimental conditions or cellular models. When designing experiments with recombinant BVES, researchers should carefully select expression systems that can appropriately process the protein to maintain physiological relevance.

How does recombinant human BVES compare to native BVES in functional assays of epithelial barrier integrity?

When comparing recombinant human BVES to native BVES in functional assays, researchers should consider several factors:

Native BVES undergoes tissue-specific post-translational modifications that may not be replicated in standard recombinant protein production systems. In epithelial barrier integrity assays, these differences can manifest as variations in protein localization, binding efficiency to junction proteins, and downstream signaling effects. Studies examining transepithelial electrical resistance (TEER) in cells treated with recombinant BVES versus cells expressing native BVES have demonstrated both overlapping and distinct functional outcomes.

To assess functional equivalence, recommended methodological approaches include:

  • Parallel assessment of tight junction formation via immunofluorescence microscopy

  • Comparative analysis of protein-protein interactions using co-immunoprecipitation

  • TEER measurements across multiple time points to capture dynamic effects

  • Paracellular permeability assays using fluorescently labeled dextrans of different molecular weights

These approaches can help determine whether recombinant BVES adequately mimics the barrier-enhancing properties of the native protein or requires further optimization of production methods.

What experimental models are most suitable for studying the effects of recombinant human BVES on intestinal inflammation?

Based on current research findings, several experimental models are particularly valuable for studying recombinant human BVES effects on intestinal inflammation:

In vitro models:

  • Intestinal epithelial cell lines (Caco-2, HT-29, T84) in two-dimensional and three-dimensional culture systems

  • Intestinal organoids derived from primary human tissue

  • Co-culture systems incorporating epithelial cells with immune cells

In vivo models:

  • BVES knockout mice, which develop more severe intestinal injury and inflammation

  • DSS-induced colitis models

  • IL-10 knockout mice (which develop spontaneous colitis)

  • Humanized mouse models for testing human-specific effects

When designing experiments with recombinant BVES, researchers should incorporate both acute and chronic inflammation paradigms, as BVES may have differential effects depending on the inflammatory time course. Methodology should include multiple readouts including histological assessment, inflammatory cytokine profiles, in vivo imaging of barrier function, and assessment of immune cell infiltration.

What methods are most effective for producing functional recombinant human BVES with proper post-translational modifications?

The production of functional recombinant human BVES requires careful consideration of expression systems to ensure proper post-translational modifications and protein folding. Based on research with similar transmembrane proteins, the following methodological approaches are recommended:

Expression Systems Comparison:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, low costLimited PTMs, improper folding of multi-domain proteinsInitial structure studies, antibody production
Insect cells (Sf9, High Five)Better folding, some PTMsIncomplete glycosylation patternsProtein-protein interaction studies
Mammalian cells (HEK293, CHO)Near-native PTMs, proper foldingLower yield, higher costFunctional assays, signaling studies
Cell-free systemsRapid production, control over conditionsLimited PTMsPreliminary binding studies

For functional recombinant human BVES production, mammalian expression systems typically yield the most physiologically relevant protein product. To verify protein functionality, researchers should:

  • Confirm membrane localization in cell-based assays

  • Verify interaction with known binding partners (e.g., tight junction proteins)

  • Assess ability to activate downstream signaling pathways (cAMP, WNT)

  • Evaluate epithelial barrier enhancement in functional assays

Quality control should include verification of glycosylation status and other relevant post-translational modifications as these may significantly impact BVES functionality.

How should researchers design experiments to study the tumor suppressor function of recombinant human BVES?

When investigating the tumor suppressor function of recombinant human BVES, experimental design should incorporate multiple levels of analysis:

Cellular level approaches:

  • Compare proliferation rates in cancer cell lines with and without recombinant BVES treatment

  • Assess c-Myc protein levels and stability following recombinant BVES administration

  • Evaluate WNT pathway activity using reporter assays

  • Measure epithelial-to-mesenchymal transition markers before and after BVES treatment

In vivo approaches:

  • Xenograft models comparing tumor growth with and without recombinant BVES treatment

  • Orthotopic models of gastrointestinal cancers with recombinant BVES administration

  • BVES knockout mice exposed to carcinogens (particularly relevant for colitis-associated cancer models)

A comprehensive experimental design should include dose-response analyses to establish effective concentrations and timing of administration. Additionally, researchers should compare recombinant BVES effects across multiple cancer types, as BVES suppression has been observed in various gastrointestinal cancers but may have tissue-specific mechanisms of action.

What are the key considerations when designing a quantitative assay to measure BVES-mediated c-Myc degradation?

When developing quantitative assays to measure BVES-mediated c-Myc degradation, researchers should consider the following methodological approaches:

Assay design considerations:

  • Temporal dynamics: c-Myc has a short half-life (~20-30 minutes), so time-course experiments must include early time points

  • Protein stabilization controls: Include proteasome inhibitors (MG132) as controls

  • Specificity controls: Include other short-lived proteins to confirm BVES specifically affects c-Myc

  • Quantification methods: Western blotting with digital image analysis, ELISA, or reporter systems

Recommended experimental protocol:

  • Treat cells with varying concentrations of recombinant human BVES

  • Harvest cells at multiple time points (0, 15, 30, 60, 120 minutes)

  • Quantify c-Myc protein levels via Western blot and densitometry

  • In parallel, measure c-Myc mRNA to distinguish transcriptional vs. post-translational effects

  • Include cycloheximide chase experiments to specifically assess protein degradation rates

For more sensitive detection, consider developing a dual-luciferase reporter system where c-Myc is fused to a luciferase reporter, allowing real-time monitoring of degradation in living cells. This approach enables high-throughput screening of factors affecting BVES-mediated c-Myc regulation.

How can researchers effectively use RNA-seq data to identify downstream targets of recombinant human BVES treatment?

RNA-seq analysis can provide comprehensive insights into the transcriptional changes induced by recombinant human BVES. An effective methodological approach includes:

Experimental design:

  • Include multiple time points after BVES treatment (early: 2-6h; intermediate: 12-24h; late: 48-72h)

  • Use appropriate cellular models (intestinal epithelial cells, cancer cell lines with suppressed endogenous BVES)

  • Include concentration-dependent treatment groups

  • Compare with BVES knockout/knockdown conditions

Analytical pipeline:

  • Standard quality control and normalization procedures

  • Differential expression analysis comparing treated vs. untreated samples

  • Time-course analysis to identify immediate vs. delayed response genes

  • Pathway enrichment analysis focusing on known BVES-regulated pathways (WNT, cAMP)

  • Network analysis to identify hub genes and potential direct vs. indirect targets

Validation approaches:

  • qRT-PCR validation of top differentially expressed genes

  • ChIP-seq to distinguish direct vs. indirect transcriptional effects

  • Protein-level validation of key targets

  • Functional assays to confirm biological relevance of identified pathways

This comprehensive approach allows researchers to construct a molecular signature of BVES activity and identify key nodes that might represent therapeutic targets or biomarkers in conditions with altered BVES expression.

What controls should be included when evaluating the effects of recombinant human BVES on WNT signaling?

When investigating recombinant human BVES effects on WNT signaling, comprehensive controls are essential for accurate interpretation:

Essential controls:

Control TypePurposeImplementation
Vehicle controlControl for buffer effectsUse same buffer composition without BVES protein
Heat-inactivated BVESControl for non-specific protein effectsHeat-treat aliquot of recombinant BVES at 95°C for 10 minutes
Known WNT pathway modulatorPositive controlInclude GSK3β inhibitor (e.g., CHIR99021) or recombinant WNT3A
Dose-responseEstablish concentration-dependent effectsTest 5+ concentrations of recombinant BVES
Timing experimentsDetermine optimal treatment durationHarvest at multiple timepoints (2h, 6h, 12h, 24h)

Readout controls:

  • Include multiple WNT pathway readouts:

    • TOPFlash reporter assay (direct measure of β-catenin-mediated transcription)

    • β-catenin nuclear localization via immunofluorescence

    • Expression of canonical WNT target genes (AXIN2, CCND1, MYC)

    • Phosphorylation status of key pathway components (LRP6, GSK3β)

  • Compare effects across multiple cell types, as WNT pathway regulation can be context-dependent

These controls help distinguish specific BVES-mediated effects from non-specific influences and provide robust validation of the protein's functional impact on WNT signaling.

How should researchers address the issue of data variability when studying BVES effects on intestinal epithelial barrier function?

Intestinal epithelial barrier function assays are inherently variable due to the complexity of the epithelial barrier. When studying recombinant human BVES effects, researchers should implement the following methodological strategies to address variability:

Experimental design considerations:

  • Use adequate biological replicates (minimum n=6 for cell culture, n=8-10 for animal studies)

  • Perform technical replicates for each measurement

  • Include longitudinal measurements where possible

  • Standardize culture conditions rigorously (passage number, confluence level, medium composition)

  • For in vivo studies, control for factors known to affect barrier function (microbiome, diet, stress)

Statistical approaches:

  • Use mixed-effects models that account for repeated measures

  • Consider non-parametric tests if data do not meet normality assumptions

  • Report effect sizes alongside p-values

  • Use appropriate post-hoc corrections for multiple comparisons

Complementary methodologies:
Employ multiple barrier function assays in parallel:

  • Transepithelial electrical resistance (TEER)

  • Paracellular flux of differently sized molecular tracers

  • Immunolocalization of tight junction proteins

  • Ultrastructural analysis via electron microscopy

By implementing these approaches, researchers can generate more robust and reproducible data when studying BVES effects on barrier function, increasing confidence in the biological significance of observed changes.

What are the key considerations for developing a valid ELISA assay to quantify recombinant human BVES in experimental samples?

Developing a sensitive and specific ELISA for recombinant human BVES requires careful consideration of several methodological factors:

Antibody selection:

  • Generate antibodies against multiple epitopes of BVES

  • Screen for antibodies that recognize both native and recombinant forms

  • Validate antibody specificity using BVES knockout samples

  • Consider using a combination of monoclonal and polyclonal antibodies for capture and detection

Assay optimization:

  • Determine optimal coating buffer pH and composition

  • Optimize antibody concentrations through checkerboard titration

  • Evaluate multiple blocking agents to minimize background

  • Test various detection systems (colorimetric, chemiluminescent, fluorescent)

Standard curve preparation:

  • Use highly purified recombinant human BVES as the standard

  • Include wide range of concentrations to ensure detection of physiological levels

  • Prepare standards in the same matrix as experimental samples

  • Include internal controls on each plate for inter-assay normalization

Validation parameters:

ParameterAcceptance CriteriaMethod
Specificity<5% cross-reactivityTest related proteins and common sample contaminants
SensitivityLOD <10 pg/mLReplicate testing of low concentration samples
PrecisionIntra-assay CV <10%, Inter-assay CV <15%Replicate testing across multiple plates and days
Recovery80-120%Spike-and-recovery in various matrices
LinearityR² >0.98Serial dilutions of samples

By thoroughly addressing these considerations, researchers can develop a reliable ELISA method for quantifying recombinant human BVES in experimental samples, enabling more precise evaluation of treatment effects and tissue distribution.

What are the most promising research directions for recombinant human BVES applications based on current evidence?

Based on the current understanding of BVES biology, several research directions stand out as particularly promising for recombinant human BVES applications:

  • Therapeutic applications in inflammatory bowel diseases: Given that mice lacking BVES sustain worse intestinal injury and inflammation, recombinant BVES administration could potentially help restore epithelial barrier function in conditions like ulcerative colitis and Crohn's disease .

  • Cancer suppression strategies: The demonstrated role of BVES in suppressing gastrointestinal cancers through mechanisms including c-Myc degradation and WNT pathway regulation suggests potential applications in cancer therapy or prevention, particularly for colitis-associated cancer .

  • Epithelial barrier enhancement: Across multiple tissues, BVES plays a role in maintaining epithelial integrity. Recombinant BVES could be explored as a therapeutic agent to strengthen compromised barriers in conditions ranging from intestinal permeability to blood-brain barrier dysfunction.

  • Molecular tool development: Engineered variants of recombinant BVES could serve as research tools to further elucidate cAMP and WNT signaling pathways, potentially leading to new therapeutic targets beyond BVES itself.

  • Biomarker development: Using insights from recombinant BVES studies, researchers could develop diagnostic approaches based on BVES expression patterns or activity levels in various disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.