Recombinant Human Bone marrow proteoglycan (PRG2), partial

Shipped with Ice Packs
In Stock

Description

Production and Purification

Key Steps

  • Host Systems: Primarily produced in E. coli for cost efficiency, with yeast used for specific isoforms .

  • Tags: Affinity tags (e.g., His, GST) simplify purification via chromatography .

  • Buffer Formulation:

    • Liquid: Tris/PBS with 5–50% glycerol .

    • Lyophilized: Tris/PBS with 6% trehalose (pH 8.0) .

Quality Control

  • Endotoxin Levels: Not tested in most commercial preparations .

  • Activity: Often labeled "not tested" due to its research-grade classification .

Functional Roles in Disease and Immunity

Mechanisms of Action

  • Antiparasitic Defense: Direct cytotoxicity against helminths .

  • Immune Hypersensitivity: Triggers histamine release from basophils, exacerbating allergic responses .

  • Disease Associations:

    • Chronic Myeloid Leukemia: Low PRG2 expression correlates with drug resistance .

    • Chronic Rhinosinusitis: Elevated PRG2 levels in nasal mucus serve as a biomarker .

    • Eosinophilic Disorders: Pathological crystalized deposits in tissues .

Research Applications

Key Studies

Application AreaFindingsCitation
Drug ResistancePRG2 downregulation linked to imatinib resistance in leukemia
Biomarker DevelopmentProMBP as a first-trimester predictor of adverse pregnancy outcomes
Innate ImmunityMBP-1 aggregation critical for eosinophil-mediated pathogen defense
Therapeutic TargetPRG2-PAPPA complex inhibits metalloproteinase activity in atherosclerosis

Tools for Analysis

  • ELISA Kits: Detect PRG2 in serum/plasma with 0.188 ng/mL sensitivity .

  • Antibodies: Polyclonal and monoclonal antibodies available for WB, IHC .

Product Specs

Buffer
For liquid delivery forms, the protein is stored in a Tris/PBS-based buffer containing 5-50% glycerol. Note: Specify your desired glycerol concentration in order notes if different from the default.
Form
Delivery format is either liquid or lyophilized powder. While we prioritize shipping the available format, please specify your preferred format in your order notes to ensure fulfillment of your request.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery timelines.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 6xHis-tagged
Synonyms
PRG2; MBP; Bone marrow proteoglycan; BMPG; Proteoglycan 2
Datasheet & Coa
Please contact us to get it.
Expression Region
106-222aa
Mol. Weight
17.8kDa
Protein Length
Partial
Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Immunology
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
PRG2
Target Protein Sequence
TCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Recombinant Human Bone marrow proteoglycan (PRG2), partial, exhibits cytotoxic and helminthotoxin activities. It also triggers non-cytolytic histamine release from human basophils and plays a role in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform functions as a proteinase inhibitor, modulating PAPPA activity.
Gene References Into Functions
  • Low PRG2 expression correlates with drug resistance in chronic myeloid leukemia. PMID: 29936783
  • MBP-1 aggregation is crucial for innate immunity and eosinophil-mediated immunopathology. MBP-1 toxicity is mitigated by crystallization within eosinophil secretory granules. PMID: 25728769
  • Free protein in nasal mucus serves as a potential biomarker for chronic rhinosinusitis diagnosis. PMID: 25266917
  • Eosinophil granule protein mRNA levels, rather than sputum eosinophil percentages, may better reflect airway hyperresponsiveness and airflow limitation. PMID: 24814827
  • This protein contains a peptide demonstrating potent antibacterial activity against Gram-positive and Gram-negative bacteria, and fungi. PMID: 319906
  • Eosinophil major basic protein activates human cord blood mast cells primed with fibroblast membranes via integrin-beta1. PMID: 24112102
  • During pregnancy, the proform of eosinophil major basic protein-angiotensinogen is the predominant form in late pregnancy. PMID: 23033876
  • Respiratory syncytial virus and MBP synergistically induce cell death in pulmonary alveolar epithelial cells (A549). PMID: 20977431
  • MBP expression in nasal mucus from chronic rhinosinusitis patients is significantly higher than in controls. PMID: 18720885
  • MBP and NE collaboratively contribute to the pathology of nasal polyps. PMID: 18476621
  • A novel transcript, alternatively transcribed from intron III of the ENO1 gene, enables MBP-1 production. PMID: 20849415
  • The proMBP is a novel first-trimester serum marker for adverse pregnancy outcomes. PMID: 19626619
  • Transcription is regulated by novel combinatorial interactions of GATA-1, PU.1, and C/EBPepsilon isoforms. PMID: 12202480
  • IGF bioactivity is regulated by reversible cell surface binding of PAPP-A, which is in turn modulated by proMBP. PMID: 12370176
  • The structure of MBP and its binding to pregnancy-associated plasma protein A are described. PMID: 12421832
  • Eosinophilic MBP deposits are observed on the surface of eosinophils and damaged muscle fibers in patients with idiopathic eosinophilic myositis. PMID: 12534990
  • MBP stimulates Src kinase-dependent activation of class I(A) phosphoinositide 3-kinase and subsequently activates protein kinase C zeta in neutrophils, contributing to NADPH oxidase activation and superoxide production. PMID: 14500673
  • The proform of MBP forms a covalent complex with PAPPA, resulting in PAPPA inhibition. PMID: 14988014
  • The proform of eosinophil major basic protein inhibits the proteolytic activity of PAPP-A. PMID: 15647258
  • Cytotoxic and cytostimulatory regions of MBP are accessible for ligand interaction in cell surface-bound MBP. PMID: 16940047
  • MBP2, found only in eosinophils, may serve as a useful biomarker for eosinophil-associated diseases, in contrast to MBP1, present in eosinophils, basophils, and a human mast cell line. PMID: 17082653
  • Pregnancy-associated plasma protein A is implicated in processes preceding vulnerable plaque development in acute coronary syndrome. PMID: 17223728
  • Knockdown of endogenous MBP-1 is involved in cellular senescence of HFF through the p53-p21 pathway. PMID: 18852884
  • No variation in major basic protein genes was observed in this German cohort with atopic dermatitis. PMID: 19014520
  • Significantly elevated proMBP levels in myelofibrosis patients suggest its potential role as an important stromal cytokine in bone marrow fibrosis. PMID: 19039208
  • Even unstimulated eosinophils contain significant amounts of MBP in secretory vesicles, in addition to granule-stored MBP. PMID: 19398958
Database Links

HGNC: 9362

OMIM: 605601

KEGG: hsa:5553

STRING: 9606.ENSP00000312134

UniGene: Hs.512633

Subcellular Location
[Bone marrow proteoglycan]: Secreted. Note=The proform is secreted.; [Eosinophil granule major basic protein]: Cytoplasmic vesicle, secretory vesicle. Note=The proform is secreted. The mature protein is found in the matrix of the eosinophil's large specific granule (crystalloid core).
Tissue Specificity
High levels of the proform in placenta and pregnancy serum; in placenta, localized to X cells of septa and anchoring villi. Lower levels in a variety of other tissues including kidney, myometrium, endometrium, ovaries, breast, prostate, bone marrow and co

Q&A

What are the recognized synonyms and protein variants of PRG2?

PRG2 is known by several alternative names in scientific literature, including:

  • Bone marrow proteoglycan (BMPG)

  • Proteoglycan 2

  • Eosinophil granule major basic protein (EMBP/MBP)

  • Pregnancy-associated major basic protein

The UniProt accession number for PRG2 is P13727, with secondary accession numbers including A6XMW0, B2R5I1, P81448, Q14227, and Q6ICT2 . The GeneID is 5553, and it can be found in the KEGG database as hsa:5553 .

What are the optimal storage and handling conditions for recombinant PRG2?

For optimal stability and activity, recombinant PRG2 should be stored according to these guidelines:

  • Short-term storage (up to one month): 2-8°C

  • Long-term storage: -20°C to -80°C

  • Avoid repeated freeze/thaw cycles to maintain protein integrity

When supplied as a lyophilized powder, the protein should be reconstituted to achieve a concentration between 0.1-1.0 mg/ml. For reconstitution:

  • Use ddH₂O to maintain the original salt concentration

  • Alternatively, use 20 mM Tris, 150 mM NaCl, pH 8.0 buffer

  • Gentle mixing is recommended; avoid vortexing

How can PRG2 expression be quantified in experimental samples?

Multiple complementary techniques can be employed for accurate quantification of PRG2:

  • ELISA-based detection:

    • Commercial sandwich ELISA kits offer high sensitivity (down to 0.188 ng/ml)

    • Detection range typically spans 0.313-20 ng/ml

    • Suitable for serum, plasma, and other biological fluids

  • Western Blotting:

    • Recombinant PRG2 can serve as a positive control

    • Typically detected at approximately 44 kDa on SDS-PAGE

    • Various antibodies are available targeting different epitopes

  • Real-time PCR (qRT-PCR):

    • Design primers specific to PRG2 mRNA

    • Use reference genes (e.g., GAPDH) as internal controls

    • Analyze expression data using the 2^(-ΔΔCt) method

MethodDetection LimitSample TypesAdvantages
ELISA0.188 ng/mlSerum, plasma, biological fluidsQuantitative, high-throughput
Western BlotVariableCell/tissue lysatesConfirms protein size, semi-quantitative
qRT-PCRVariableRNA from cells/tissuesMeasures gene expression

What experimental controls should be included when studying PRG2 in hematopoietic stem cells?

When investigating PRG2 function in hematopoietic stem cells (HSCs), include these essential controls:

  • Positive Controls:

    • Known PRG2-expressing cell populations

    • Recombinant PRG2 protein (>90% purity) for antibody validation

    • Cells overexpressing PRG2

  • Negative Controls:

    • PRG2 knockout or knockdown cells

    • Isotype-matched antibodies for immunological techniques

    • Non-targeting siRNA/shRNA for knockdown experiments

  • Comparative Analysis:

    • Examine both CD34+ and CD34- hematopoietic stem/progenitor cell populations

    • Compare expression with other stemness markers (OCT4, NANOG, SOX2)

    • Include analysis of functionally related proteins (IDH2, PGK1, PRDX2, RAC2, etc.)

How does PRG2 contribute to hematopoietic stem cell biology?

Proteomics research has identified PRG2 as part of a network of proteins involved in maintaining hematopoietic stem cells. The specific contributions include:

  • Cellular Signaling:

    • PRG2 appears to participate in signaling pathways relevant to stem cell maintenance

    • Functions alongside other differentially expressed proteins in HSC/HPC subsets

  • Extracellular Matrix Organization:

    • As a proteoglycan, PRG2 likely contributes to the organization of the bone marrow extracellular matrix

    • May influence interactions between stem cells and their microenvironment

  • Tissue Development:

    • Dysregulation of PRG2 has been linked to various bone marrow disorders

    • Potentially serves as a biomarker for specific hematopoietic conditions

How can PRG2 functionality be studied in different experimental systems?

To comprehensively investigate PRG2 function across various experimental systems:

  • In vitro cell culture approaches:

    • Supplement culture media with purified recombinant PRG2 (0.1-100 ng/ml range)

    • Generate PRG2 knockdown/knockout models using siRNA or CRISPR-Cas9

    • Create inducible expression systems to control PRG2 levels temporally

  • Ex vivo analyses:

    • Isolate primary bone marrow samples using standardized protocols

    • Perform functional assays comparing PRG2-high and PRG2-low populations

    • Conduct co-culture experiments with stromal cells

  • Functional assessments:

    • Measure stemness markers (OCT4, NANOG, SOX2) by qRT-PCR

    • Evaluate proliferation, self-renewal, and differentiation capacity

    • Assess protein-protein interactions using co-immunoprecipitation or proximity ligation assays

How can contradictory findings about PRG2 function be reconciled in experimental designs?

When encountering conflicting results regarding PRG2 function:

  • Technical variability assessment:

    • Evaluate differences in recombinant protein preparations (tags, expression systems)

    • Consider variations in antibody specificity and detection methods

    • Account for cell type-specific effects and experimental context

  • Experimental design optimization:

    • Employ multiple complementary techniques to measure the same outcome

    • Include appropriate positive and negative controls as described above

    • Consider kinetic studies rather than single time points

    • Account for post-translational modifications and protein processing

  • Integrated analysis framework:

    • Compare experimental conditions systematically

    • Develop computational models to predict context-dependent behavior

    • Consider regional peculiarities and ethnic-specific factors that might influence results

What methodological challenges exist when studying PRG2 interactions with the bone marrow microenvironment?

Several methodological challenges must be addressed:

  • Complex cellular environment:

    • Multiple cell types with dynamic interactions

    • Difficulty in maintaining 3D architecture in vitro

    • Temporal changes in microenvironment composition

  • Technical limitations:

    • Limited availability of bone marrow samples for research

    • Challenges in visualizing interactions in living systems

    • Difficulty reproducing hypoxic conditions of the bone marrow niche

  • Integrative approaches needed:

    • Combination of in vitro, ex vivo, and in vivo models

    • Multi-omics profiling for comprehensive characterization

    • Systems biology approaches to model complex interactions

What computational resources are available for analyzing PRG2 in stem cell biology contexts?

Researchers can utilize various computational resources:

  • Database resources:

    • UniProt (P13727) for protein sequence and annotation

    • KEGG (hsa:5553) for pathway mapping

    • STRING database (9606.ENSP00000312134) for protein-protein interactions

  • Network analysis tools:

    • Proteomics data indicate that PRG2 functions alongside proteins including IDH2, PGK1, PRDX2, and RAC2

    • Computational pathway analysis can help predict functional relationships

    • Various algorithms for network reconstruction from proteomics data

  • Expression analysis platforms:

    • Tools for analyzing PRG2 expression across different cell types

    • Single-cell RNA-seq analysis pipelines

    • Specialized stem cell expression databases

How should researchers normalize and analyze PRG2 expression data?

For robust analysis of PRG2 expression:

  • Platform-specific normalization:

    • For qRT-PCR: Use stable reference genes validated for each experimental condition

    • For proteomics: Apply appropriate normalization strategies (total protein, spike-in standards)

    • For ELISA: Include standard curves in each assay

  • Statistical analysis framework:

    • Test for normal distribution before selecting parametric/non-parametric tests

    • Use appropriate multiple testing correction

    • Consider hierarchical models for complex experimental designs

  • Data visualization:

    • Use consistent plotting methods across datasets

    • Include measures of variability (standard deviation, confidence intervals)

    • Provide access to raw data when possible

How can researchers troubleshoot inconsistent PRG2 detection?

When facing inconsistent PRG2 detection:

  • Sample preparation considerations:

    • Verify protein extraction methods are suitable for proteoglycans

    • Consider the presence of post-translational modifications

    • Evaluate sample storage conditions and freeze-thaw history

  • Detection method optimization:

    • For Western blotting: Optimize antibody concentration and incubation conditions

    • For ELISA: Check for matrix effects and consider sample dilution series

    • Include recombinant PRG2 as positive control (>90% purity)

  • Quality control measures:

    • Verify protein identity using mass spectrometry

    • Confirm antibody specificity through knockout/knockdown validation

    • Run purity checks using SDS-PAGE before experiments

What quality control parameters should be evaluated for recombinant PRG2?

Essential quality control parameters include:

  • Purity assessment:

    • SDS-PAGE analysis (should show >90% purity)

    • Mass spectrometry confirmation of protein identity

  • Functional verification:

    • Binding assays with known interaction partners

    • Cellular response assays in appropriate model systems

  • Storage stability:

    • Verification of activity after storage at recommended conditions

    • Assessment of freeze-thaw stability

    • Monitoring for degradation products

What emerging technologies might advance our understanding of PRG2 function?

Promising technological approaches include:

  • Single-cell technologies:

    • Single-cell RNA sequencing to identify cell-specific expression patterns

    • Single-cell proteomics for protein-level analysis

    • Spatial transcriptomics to map PRG2 expression within tissues

  • Advanced imaging approaches:

    • Super-resolution microscopy for subcellular localization

    • Live-cell imaging to track PRG2 dynamics

    • Proximity labeling for protein interaction mapping

  • Genome editing advances:

    • CRISPR-Cas9 precision editing for functional studies

    • CRISPR activation/interference for endogenous gene regulation

    • Tagged endogenous PRG2 for physiological expression levels

What potential clinical applications exist for PRG2 research?

Understanding PRG2 function may lead to several clinical applications:

  • Diagnostic biomarkers:

    • PRG2 levels or modifications may serve as indicators of specific hematopoietic disorders

    • Development of standardized assays for clinical laboratory use

  • Therapeutic targets:

    • Modulation of PRG2 function might influence stem cell behavior

    • Potential applications in bone marrow transplantation or regenerative medicine

  • Personalized medicine approaches:

    • Patient-specific PRG2 expression patterns might inform treatment decisions

    • Integration with other biomarkers for comprehensive disease profiling

What regulatory guidelines apply to research using recombinant PRG2?

Researchers should adhere to these important guidelines:

  • Research use restrictions:

    • Recombinant PRG2 is for research use only

    • Not for use in diagnostic procedures or therapeutic applications

    • Not for human or animal consumption

  • Laboratory safety considerations:

    • Follow institutional biosafety guidelines for recombinant protein handling

    • Implement appropriate personal protective equipment protocols

    • Adhere to waste disposal regulations for biological materials

  • Ethical research practices:

    • Obtain appropriate IRB approval for studies involving human samples

    • Ensure informed consent for bone marrow donors

    • Maintain data privacy and security in accordance with institutional policies

How should researchers approach study design when using primary human samples for PRG2 research?

When designing studies with primary human samples:

  • Sample collection and processing:

    • Implement standardized protocols for bone marrow or blood collection

    • Minimize ex vivo manipulation to preserve native state

    • Document donor characteristics and clinical parameters

  • Experimental design considerations:

    • Perform paired analysis (same donor) whenever possible

    • Calculate sufficient sample size based on statistical power requirements

    • Account for donor variability (age, sex, ethnicity, clinical status)

  • Reporting standards:

    • Follow ARRIVE guidelines for experimental reporting

    • Provide comprehensive methodology details to enable reproducibility

    • Acknowledge limitations related to primary sample variability

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.