Recombinant Human Brain mitochondrial carrier protein 1 (SLC25A14)

Shipped with Ice Packs
In Stock

Description

Gene Structure

The SLC25A14 gene is located on the X chromosome in humans . This gene undergoes alternative splicing, resulting in multiple transcript variants . Two specific splice variants have been identified for this gene, suggesting potential functional diversity in different tissues or cellular contexts . The gene has been mapped in detail, with reference sequences available for both genomic and mRNA forms.

Table 1: Basic Information of SLC25A14
Protein NameBrain mitochondrial carrier protein 1
Gene NameSLC25A14
AliasesMitochondrial uncoupling protein 5 (UCP5), Solute carrier family 25 member 14
OrganismHomo sapiens (Human)
UniProt IDO95258
Transmembrane Domains6
Length (amino acids)325
Chromosome LocationX chromosome
Major Expression SitesBrain, testis
Subcellular LocalizationInner mitochondrial membrane

Tissue Distribution

SLC25A14 exhibits a broad expression pattern across human tissues, though with notable tissue specificity. The protein is widely expressed in many tissues, with the greatest abundance found in brain and testis . This distribution pattern aligns with its designation as a brain mitochondrial carrier protein, highlighting its potentially specialized functions in neural tissues.

According to data from the Human Protein Atlas, SLC25A14 shows expression across multiple brain regions, including the cerebral cortex, cerebellum, basal ganglia, hippocampal formation, amygdala, and midbrain . The widespread distribution in brain tissues suggests important roles in neural function and potentially in neuroprotection.

Table 2: Tissue Expression Profile of SLC25A14
Tissue TypeExpression Level
Brain (various regions)High
TestisHigh
Heart muscleModerate
KidneyModerate
LiverModerate
Other tissuesLow to moderate

Subcellular Localization

At the subcellular level, SLC25A14 is primarily localized to the inner mitochondrial membrane . This localization is critical for its function as a transporter of metabolites and its role in mitochondrial uncoupling. Positioned within the inner mitochondrial membrane, SLC25A14 can facilitate the movement of ions across the membrane, affecting the proton gradient that drives ATP synthesis.

Mitochondrial Uncoupling Activity

As a member of the uncoupling protein family, SLC25A14 plays a significant role in mitochondrial uncoupling, a process that separates oxidative phosphorylation from ATP synthesis . This uncoupling results in energy dissipation as heat, a phenomenon also referred to as mitochondrial proton leak . The protein facilitates the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane .

Through this activity, SLC25A14 helps reduce the mitochondrial membrane potential in mammalian cells . The exact mechanisms by which SLC25A14 transfers H+/OH- ions are not fully understood, as the specific methods of transport for different UCPs remain to be elucidated .

Metabolic Regulation

Beyond its uncoupling function, SLC25A14 contributes to broader aspects of cellular metabolism. The expression of SLC25A14 is enhanced in human cerebral ischemic injury in vitro, suggesting a role in the cellular response to metabolic stress . This upregulation appears to have long-term neuroprotective effects by reducing the mitochondrial membrane potential and consequently decreasing the production of reactive oxygen species .

The reduction in oxygen species can be determined by increased activity of superoxide degrading enzymes alongside SLC25A14 . This function highlights the protein's potential role in cellular defense mechanisms against oxidative stress, particularly in neural tissues where metabolic demands are high.

Neuroprotection

SLC25A14 has been implicated in neuroprotection against various neurodegenerative conditions. Research has demonstrated that decreasing redox signaling and specific UCPs, including SLC25A14, have neuroprotective roles that can shield against conditions such as hypoxia, ischemia, and diseases like Alzheimer's disease, Parkinson's disease, and schizophrenia .

The neuroprotective function of SLC25A14 is thought to be mediated through its ability to reduce mitochondrial membrane potential and consequently decrease the production of reactive oxygen species . Since oxidative stress and mitochondrial dysfunction are common features of many neurodegenerative diseases, SLC25A14 represents a potential therapeutic target for these conditions.

Potential Role in Cancer

Recent bioinformatic investigations have revealed potential roles for mitochondrial solute carriers, including members of the SLC25 family, in cancer. A study focusing on colon cancer revealed that mitochondrial SLC25 family members have prognostic value in patients .

The SLC25 family members with high-risk scores were associated with phenotypes of increasing tumor immune infiltration and decreasing glycolysis and apoptosis contents . While the specific role of SLC25A14 in cancer biology requires further investigation, these findings highlight the potential relevance of mitochondrial carrier proteins in cancer progression and prognosis.

Production Methods

Recombinant SLC25A14 protein can be produced using various expression systems, with mammalian cell lines such as HEK293 being commonly employed to ensure proper folding and post-translational modifications . The recombinant proteins are typically tagged to facilitate purification and detection, with common tags including His, Fc, and Avi tags .

Production protocols aim to achieve high purity levels (≥85% by SDS-PAGE) and low endotoxin content (<1.0 EU per μg of protein) . The recombinant proteins are typically stored in PBS buffer and are stable for at least 6 months when properly stored, though repeated freeze-thaw cycles should be avoided .

Table 3: Characteristics of Recombinant SLC25A14 Protein
Expression SystemHEK293 cells
Common TagsHis, Fc, Avi
Purity≥85% by SDS-PAGE
Endotoxin Level<1.0 EU per μg
Storage BufferPBS
Stability≥6 months at -20 to -80°C
Storage RecommendationAvoid repeated freeze-thaw cycles

Research Applications

Recombinant SLC25A14 proteins have various applications in research settings. These include:

  1. Studies on protein-protein interactions involving mitochondrial carriers

  2. Functional assays of mitochondrial transport and uncoupling activity

  3. Investigations into the role of SLC25A14 in neuroprotection

  4. Research on potential therapeutic applications for neurodegenerative diseases

  5. Structural studies to elucidate the mechanisms of ion transport

The availability of recombinant forms of SLC25A14 facilitates these research efforts by providing a reliable and consistent source of the protein for experimental studies.

Future Research Directions

Despite significant advances in understanding the structure and function of SLC25A14, several areas remain to be explored. Future research directions may include:

  1. Elucidating the exact mechanism of H+/OH- transport by SLC25A14 and how this contributes to mitochondrial uncoupling

  2. Investigating the specific roles of SLC25A14 in different brain regions and how these relate to neuronal function and neuroprotection

  3. Exploring the potential of SLC25A14 as a therapeutic target for neurodegenerative diseases

  4. Examining the relationship between SLC25A14 and cancer development, particularly in relation to mitochondrial metabolism and cell death pathways

  5. Developing improved recombinant production systems for SLC25A14 to facilitate structural studies and drug development efforts

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format preferences. Please clearly indicate your requirements when placing your order, and we will ensure your request is met.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We advise storing working aliquots at 4°C for up to one week.
Reconstitution
To ensure optimal reconstitution, briefly centrifuge the vial before opening to gather the contents at the bottom. We recommend reconstituting the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference for your own preparations.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. To facilitate multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be established during the production process. If you have a particular tag type in mind, please inform us, and we will prioritize development according to your specifications.
Synonyms
SLC25A14; BMCP1; UCP5; UNQ791/PRO1682; Brain mitochondrial carrier protein 1; BMCP-1; Mitochondrial uncoupling protein 5; UCP 5; Solute carrier family 25 member 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-325
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
SLC25A14
Target Protein Sequence
MGIFPGIILIFLRVKFATAAVIVSGHQKSTTVSHEMSGLNWKPFVYGGLASIVAEFGTFP VDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYGTI KIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSM IGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFV SSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFW PNWLRLGPWNIIFFITYEQLKRLQI
Uniprot No.

Target Background

Function
Brain mitochondrial carrier protein 1 (SLC25A14) plays a role in the mitochondrial proton leak observed in brain mitochondria.
Gene References Into Functions
  1. Elevated expression of cerebral UCP5 and UCP4 is observed in a model of high altitude hypoxia and mitochondrial oxidative phosphorylation deficiency. PMID: 23266757
  2. Neuronal UCP5 exhibits transmembrane chloride transport activity. PMID: 22524567
  3. Studies have revealed significant associations between genetic variants in the SIRT6 and UCP5 genes and atherosclerotic plaque formation. PMID: 22087257
  4. Elevated levels of UCP5 are linked to mitochondrial dysfunction in colonic cells. PMID: 19910678
  5. UCP5 is expressed in skeletal muscle as three distinct isoforms. The expression level of UCP5SI exhibits a positive correlation with resting metabolic rate and lipid oxidation rate during a euglycemic clamp with infusion of insulin at a physiologic concentration. PMID: 12051969
  6. UCP5 may play a significant role in the pathology of oxidative stress-induced neurodegeneration. PMID: 16941493
  7. The brain may respond to neuroprotection through the increased expression of UCP5 under ischemic conditions. PMID: 18018477

Show More

Hide All

Database Links

HGNC: 10984

OMIM: 300242

KEGG: hsa:9016

STRING: 9606.ENSP00000218197

UniGene: Hs.194686

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Mainly expressed in brain. Some expression in testis and pituitary.

Q&A

What is SLC25A14 and how does it relate to other mitochondrial carrier proteins?

SLC25A14, also known as Brain Mitochondrial Carrier Protein 1 (BMCP1), is a novel homologue of mitochondrial carriers predominantly expressed in the central nervous system. Structurally, SLC25A14 is a member of the solute carrier family 25 (SLC25), the largest human solute transport protein family with 53 members . This protein family is characterized by a distinctive three-domain structure featuring six transmembrane α-helices and a 3-fold repeated motif of hydrophobic and charged residues .

Sequence analysis reveals that SLC25A14 shares varying degrees of identity with other mitochondrial carriers: 39% with mitochondrial oxoglutarate carrier, 31% with phosphate carrier, 30% with adenine nucleotide translocator, and 34-39% with uncoupling proteins UCP1, UCP2, and UCP3 . Despite being more distantly related to the uncoupling protein family in terms of sequence, functional analysis suggests that SLC25A14 could potentially be considered a fourth member of the UCP family due to its marked uncoupling activity of respiration .

What is the genomic organization and chromosomal location of SLC25A14?

SLC25A14 demonstrates interesting genomic characteristics relevant to researchers studying its expression and regulation. Chromosomal mapping studies have determined that the SLC25A14 gene is located on chromosome X in mice and at position Xq24 in humans . This X-chromosomal localization has significant implications for expression patterns, potentially contributing to sex-specific differences in mitochondrial function observed in various tissues, particularly in the brain.

The gene structure includes multiple exons that encode the functional domains of the protein, including the characteristic transmembrane regions common to the SLC25 family. Understanding this genomic organization is crucial for designing experiments involving gene manipulation, such as knockout or knockdown studies, as well as for investigating potential regulatory elements that control SLC25A14 expression in different tissue types and under various physiological conditions.

What is the functional role of SLC25A14 in mitochondrial metabolism?

SLC25A14 functions primarily as a mitochondrial carrier protein located in the inner mitochondrial membrane, where it participates in the transport of various metabolites. Particularly significant is its uncoupling activity observed in respiration studies. When expressed in yeast, analysis of respiration rates in recombinant yeast or yeast spheroplasts revealed a marked uncoupling effect, particularly evident in the relationship between respiratory rate and membrane potential .

The protein is believed to regulate reactive oxygen species (ROS) production, which plays a critical role in cellular oxidative stress responses and mitochondrial function . As a member of the SLC25 family, SLC25A14 influences cellular phenotype by providing pathways linking cytoplasmic solutes and the mitochondrial matrix, thereby affecting the distribution and concentration of transported substrates . This function allows SLC25A14 to indirectly influence energy metabolism occurring in the mitochondria, similar to how other family members, such as SLC25A4 (ANT1), directly affect energy output from oxidative phosphorylation by transporting ADP and ATP across the mitochondrial inner membrane .

How is SLC25A14 expression distributed across different tissues?

Northern analysis studies of mouse, rat, and human tissues have demonstrated that SLC25A14 mRNA is predominantly expressed in brain tissue, although it is also present in other tissues at levels 10-30 fold lower than in the brain . This differential expression pattern suggests tissue-specific roles for SLC25A14, with a particularly important function in the central nervous system.

Within the brain, in situ hybridization analysis has revealed that SLC25A14 is not uniformly distributed but shows regional specificity. The protein is particularly abundant in the cortex, hippocampus, thalamus, amygdala, and hypothalamus . This expression pattern in regions associated with higher cognitive functions, memory, sensory processing, emotional responses, and homeostatic regulation suggests that SLC25A14 may play specialized roles in supporting the high metabolic demands of these brain regions.

What methods are most effective for detecting SLC25A14 expression in tissue samples?

For researchers investigating SLC25A14 expression, several methodological approaches can be employed depending on the research question and available samples. At the mRNA level, Northern blot analysis has been successfully used to detect SLC25A14 expression across various tissues . For more sensitive and quantitative analysis, quantitative PCR (qPCR) is recommended, which allows detection of lower expression levels and precise quantification.

For spatial localization within tissues, in situ hybridization has proven effective, particularly for brain tissue where SLC25A14 shows regional variation in expression levels . At the protein level, immunohistochemistry or immunofluorescence using specific antibodies against SLC25A14 can provide detailed information about cellular and subcellular localization. Western blotting can be employed for semi-quantitative analysis of protein expression levels across different samples or experimental conditions.

Single-cell RNA sequencing approaches are increasingly valuable for understanding cell-type specific expression patterns, particularly in heterogeneous tissues like the brain. This methodology can reveal whether SLC25A14 is expressed in specific neuronal or glial subtypes, providing insights into its functional specialization.

What expression systems are most suitable for recombinant SLC25A14 production?

For researchers interested in producing recombinant SLC25A14 for functional studies, several expression systems have been employed with varying degrees of success. Yeast expression systems, particularly Saccharomyces cerevisiae, have been successfully used to express recombinant SLC25A14, although it should be noted that expression of the protein in yeast strongly impaired growth rate . This growth impairment may be related to the uncoupling activity of the protein, which affects mitochondrial function.

Bacterial expression systems like E. coli may be suitable for producing portions of the protein for structural studies or antibody production, but may not provide proper folding or post-translational modifications for full-length functional studies. Mammalian cell expression systems (such as HEK293 or CHO cells) offer advantages for studying the functional properties of SLC25A14 in a more physiologically relevant context, with appropriate post-translational modifications and cellular machinery.

Researchers should consider including appropriate purification tags (such as His-tag or FLAG-tag) to facilitate protein isolation, while being mindful that tags may interfere with protein function and should be validated. For functional studies, it is advisable to compare tagged and untagged versions or to use cleavable tags that can be removed after purification.

What functional assays are recommended for evaluating SLC25A14 activity?

To assess the uncoupling activity of SLC25A14, respiration analysis of recombinant systems (such as yeast spheroplasts) can be performed, focusing on the relationship between respiratory rate and membrane potential . This approach allows for direct measurement of the protein's impact on mitochondrial coupling efficiency.

Membrane potential assays using fluorescent dyes such as JC-1, TMRM, or Rhodamine 123 can provide insights into how SLC25A14 affects mitochondrial membrane potential under various conditions. Oxygen consumption measurements using instruments like the Seahorse XF Analyzer allow for real-time assessment of mitochondrial respiration parameters, including basal respiration, ATP production, proton leak, and maximal respiratory capacity in cells expressing SLC25A14.

For investigating the role of SLC25A14 in ROS regulation, fluorescent probes such as DCF-DA for general ROS detection or MitoSOX for mitochondrial superoxide can be employed. Additionally, calcium flux assays may be valuable given the role of other SLC25 family members in calcium homeostasis and the known interaction between calcium signaling and mitochondrial function.

What are the optimal conditions for assessing SLC25A14 transport activity?

When designing transport assays for SLC25A14, researchers should consider reconstituting the purified protein into liposomes for controlled transport studies. This system allows for precise manipulation of substrate concentrations and membrane conditions. The assay buffer composition should be carefully optimized, considering pH (typically physiological pH 7.2-7.4), ionic strength, and the presence of specific ions that may affect transport activity.

Temperature is an important parameter, with transport assays typically performed at 30-37°C to reflect physiological conditions. Substrate selection should be guided by the known functional similarities of SLC25A14 to other mitochondrial carriers, including potentially testing various metabolites such as fatty acids, amino acids, or nucleotides. Detection methods may include radiolabeled substrates for direct transport measurements, fluorescent substrates for real-time monitoring, or indirect measurements such as pH changes or coupled enzyme assays depending on the transported substrate.

Control experiments should include known inhibitors of mitochondrial carriers (such as carboxyatractyloside for adenine nucleotide transporters) to establish specificity, and comparison with known uncoupling agents (such as FCCP or DNP) when studying the uncoupling activity of SLC25A14.

What is the role of SLC25A14 in neurological disorders?

Given its predominant expression in the brain, particularly in regions associated with higher cognitive functions and emotional processing, SLC25A14 may have implications for various neurological disorders. As a regulator of mitochondrial function and ROS production, SLC25A14 could contribute to neurodegenerative conditions where mitochondrial dysfunction and oxidative stress play central roles, such as Alzheimer's disease, Parkinson's disease, and amyotrophic lateral sclerosis.

Methodologically, researchers investigating the connection between SLC25A14 and neurological disorders should consider several approaches. Case-control studies comparing SLC25A14 expression or genetic variations between affected individuals and healthy controls can provide initial evidence for involvement. Animal models with SLC25A14 knockout or overexpression, particularly focused on behavioral and cognitive assessments, can elucidate functional consequences of altered SLC25A14 activity.

Cell culture models using neurons or glial cells with manipulated SLC25A14 expression can help identify cellular mechanisms, including effects on mitochondrial function, ROS production, apoptosis sensitivity, and calcium homeostasis. Additionally, genetic association studies may reveal whether polymorphisms in SLC25A14 are associated with disease risk or progression in specific neurological conditions.

How is SLC25A14 implicated in cancer biology?

SLC25A14 (also referred to as UCP5) has been identified as playing a critical role in the pathogenesis of head and neck paraganglioma . This association suggests potential involvement in tumorigenesis, possibly through its effects on mitochondrial metabolism and ROS regulation. Several members of the SLC25 family have been linked to various cancers, acting either as tumor promoters or suppressors, suggesting that SLC25A14 may have similar roles in specific cancer contexts.

For researchers investigating the oncological aspects of SLC25A14, several methodological approaches are recommended. Expression analysis comparing SLC25A14 levels between tumor and corresponding normal tissues can identify potential dysregulation. Correlation studies between SLC25A14 expression and clinical parameters (such as tumor grade, stage, metastasis, and patient survival) can reveal prognostic significance.

Functional studies using cancer cell lines with SLC25A14 knockdown or overexpression should assess effects on proliferation, apoptosis resistance, migration, invasion, and metabolic parameters. Particular attention should be paid to mitochondrial function and ROS levels, given SLC25A14's known role in these processes. In vivo studies using xenograft models with manipulated SLC25A14 expression can confirm in vitro findings and evaluate effects on tumor growth and metastasis in a physiological context.

What is known about SLC25A14 in the pathogenesis of head and neck paraganglioma?

SLC25A14 (UCP5) has been specifically mentioned in research as playing a critical role in the pathogenesis of head and neck paraganglioma . Paragangliomas are rare neuroendocrine tumors that develop from paraganglia, which are clusters of cells associated with the autonomic nervous system. The involvement of SLC25A14 in these tumors likely relates to its function in regulating ROS production and mitochondrial metabolism.

Researchers interested in this specific association should consider a multi-faceted investigative approach. Immunohistochemical analysis of paraganglioma tissue samples can confirm SLC25A14 protein expression and localization within tumor cells. Comparison with adjacent normal tissue can reveal differential expression patterns. Molecular studies examining the mechanisms of SLC25A14 dysregulation in paraganglioma, including genetic alterations, epigenetic changes, or transcriptional regulation, may uncover the underlying cause of altered expression.

Functional studies in paraganglioma cell lines or primary cultures with SLC25A14 manipulation can assess its role in tumor cell survival, proliferation, and metabolic phenotype. Particular focus should be placed on how SLC25A14 affects mitochondrial function in paraganglioma cells, including oxygen consumption, ROS production, and response to metabolic stressors. Additionally, investigation of potential interplay between SLC25A14 and hypoxia signaling pathways may be valuable, as paragangliomas often show activation of hypoxia-related pathways.

How does SLC25A14 interact with other mitochondrial proteins in regulating cellular metabolism?

SLC25A14, as a member of the mitochondrial carrier family with uncoupling properties, likely engages in complex interactions with other mitochondrial proteins to regulate cellular metabolism. Understanding these interactions requires sophisticated experimental approaches. Protein-protein interaction studies using co-immunoprecipitation, proximity ligation assays, or crosslinking followed by mass spectrometry can identify direct binding partners of SLC25A14 in the mitochondrial membrane.

Researchers should investigate potential functional interactions with respiratory chain complexes, as uncoupling proteins can influence electron transport chain activity. Blue native PAGE combined with activity assays can reveal associations with respiratory complexes or supercomplexes. Additionally, potential interactions with other mitochondrial carriers, particularly other uncoupling proteins (UCP1-3), should be examined to determine whether SLC25A14 functions independently or as part of a coordinated carrier system.

What are the mechanisms regulating SLC25A14 expression and activity?

Understanding the regulation of SLC25A14 at both the expression and activity levels presents an important research avenue. For transcriptional regulation studies, promoter analysis using reporter assays can identify key regulatory elements controlling SLC25A14 expression. Chromatin immunoprecipitation (ChIP) experiments can identify transcription factors binding to the SLC25A14 promoter under various conditions.

Post-transcriptional regulation should be investigated through analysis of mRNA stability, potential microRNA targeting sites, and alternative splicing patterns that might generate variant forms of SLC25A14 with altered functions. At the protein level, researchers should examine post-translational modifications such as phosphorylation, acetylation, or ubiquitination that might regulate SLC25A14 activity or stability. Mass spectrometry approaches can identify specific modification sites, while site-directed mutagenesis can confirm their functional significance.

The potential allosteric regulation of SLC25A14 by metabolites or signaling molecules should be investigated through transport activity assays in the presence of candidate regulators. Additionally, studies examining how cellular stress conditions (oxidative stress, nutrient deprivation, hypoxia) affect SLC25A14 expression and activity can provide insights into its physiological regulation and adaptive roles.

What are the most promising approaches for targeting SLC25A14 in therapeutic development?

For researchers interested in therapeutic applications related to SLC25A14, several strategic approaches warrant consideration. High-throughput screening methodologies can be employed to identify small molecule modulators (activators or inhibitors) of SLC25A14 activity. Assay development should focus on measuring uncoupling activity or transport function in cellular or reconstituted systems.

Structure-based drug design approaches may be valuable if structural data becomes available, either through experimental determination (X-ray crystallography, cryo-EM) or through computational modeling based on homologous proteins. Virtual screening against a modeled SLC25A14 structure could identify potential binding sites and candidate compounds for experimental validation.

Gene therapy approaches for conditions involving SLC25A14 dysfunction might include viral vector-mediated expression in tissues with deficient function or CRISPR-based strategies for correcting pathogenic mutations. For specific conditions where SLC25A14 overexpression contributes to pathology, RNA interference (RNAi) or antisense oligonucleotides targeting SLC25A14 mRNA could be developed.

Preclinical evaluation of any therapeutic candidates should include assessment in relevant cell culture models and animal models of diseases where SLC25A14 dysfunction has been implicated, with particular attention to potential side effects given the protein's role in fundamental mitochondrial processes.

What are the key considerations for developing knockout or knockdown models of SLC25A14?

When developing genetic models to study SLC25A14 function, researchers should consider several methodological factors. For CRISPR/Cas9-mediated knockout approaches, guide RNA design should target early exons or critical functional domains to ensure complete loss of function. The X-chromosomal location of SLC25A14 in humans and mice necessitates special considerations for achieving homozygous knockouts, particularly in male subjects where a single targeted allele would result in complete knockout.

For RNA interference approaches, carefully designed siRNAs or shRNAs with confirmed specificity should target conserved regions of SLC25A14 mRNA. Validation of knockdown efficiency should employ both mRNA quantification (qPCR) and protein detection (Western blot) to confirm effective silencing. Inducible knockdown systems may be valuable for temporal control of SLC25A14 depletion, particularly if constitutive loss proves lethal or developmentally compromising.

Importantly, researchers should establish appropriate controls, including rescue experiments where wild-type SLC25A14 is reintroduced to confirm that observed phenotypes are specifically due to SLC25A14 deficiency rather than off-target effects. Phenotypic analysis should encompass mitochondrial function parameters (membrane potential, respiration rates, ROS production) as well as broader cellular functions (growth rate, stress resistance, metabolic profiles) to comprehensively understand SLC25A14's roles.

How can researchers effectively measure the uncoupling activity of SLC25A14 in different experimental systems?

Quantifying the uncoupling activity of SLC25A14 requires specialized methodologies tailored to different experimental systems. In isolated mitochondria or mitochondrial preparations from cells expressing SLC25A14, oxygen consumption measurements in the presence of specific substrates can directly assess uncoupling activity. The respiratory control ratio (state 3/state 4 respiration) and the effect of ATP synthase inhibitors (oligomycin) can reveal the degree of coupling/uncoupling.

Membrane potential measurements using potentiometric fluorescent dyes provide another approach to quantify uncoupling. In this method, decreased fluorescence intensity or altered dye distribution in the presence of SLC25A14 would indicate uncoupling activity. Proton leak kinetics, measured as the relationship between oxygen consumption and membrane potential during progressive inhibition of the respiratory chain, offer a more detailed assessment of uncoupling properties.

For cellular systems, the Seahorse XF Analyzer allows real-time measurement of oxygen consumption rate (OCR) and extracellular acidification rate (ECAR), providing insights into how SLC25A14 affects various aspects of mitochondrial function. Comparative analysis between wild-type cells and those with manipulated SLC25A14 expression should focus on parameters such as proton leak, ATP production efficiency, and maximal respiratory capacity to quantify uncoupling effects.

Table 1: Comparison of Methods for Assessing SLC25A14 Uncoupling Activity

MethodParameters MeasuredAdvantagesLimitationsAppropriate Systems
Oxygen Electrode (Clark-type)Oxygen consumption rateDirect measurement of respiratory activityLimited throughputIsolated mitochondria, yeast spheroplasts
Membrane Potential FluorescenceMitochondrial membrane potentialReal-time monitoring possiblePotential artifacts from dye propertiesIsolated mitochondria, intact cells
Seahorse XF AnalyzerOCR, ECAR, proton leakSimultaneous measurement of multiple parametersRequires specialized equipmentIntact adherent cells
MicrocalorimetryHeat productionDirect measure of energy efficiencyLow throughput, specialized equipmentCellular or mitochondrial preparations
Proton Leak KineticsRelationship between oxygen consumption and membrane potentialComprehensive characterization of uncoupling propertiesTechnically challengingIsolated mitochondria

What are the major unresolved questions regarding SLC25A14 function and regulation?

Despite progress in understanding SLC25A14, several critical questions remain unresolved. The precise physiological substrates transported by SLC25A14 have not been definitively identified, limiting our understanding of its specific role in mitochondrial metabolism. While it shows uncoupling activity, the exact mechanism and regulation of this function under different physiological conditions remains to be elucidated.

The physiological significance of SLC25A14's predominant expression in specific brain regions (cortex, hippocampus, thalamus, amygdala, and hypothalamus) is not fully understood. This regional specificity suggests specialized functions that may relate to the metabolic demands of these brain areas or to neuronal activity regulation, but detailed studies linking SLC25A14 to specific neuronal functions are lacking.

Additionally, while SLC25A14 has been implicated in head and neck paraganglioma , the mechanisms by which it contributes to tumor development or progression are not fully characterized. Understanding whether SLC25A14 functions primarily as a tumor promoter or suppressor in different cancer contexts requires further investigation.

How might advances in structural biology contribute to understanding SLC25A14 function?

Structural biology approaches hold significant promise for advancing our understanding of SLC25A14. High-resolution structural determination through techniques such as X-ray crystallography, cryo-electron microscopy, or nuclear magnetic resonance spectroscopy could reveal critical insights into the protein's transport mechanism, substrate binding sites, and conformational changes during transport cycles.

Comparative structural analysis with other members of the SLC25 family, particularly the uncoupling proteins (UCPs) with which SLC25A14 shares functional similarities, could identify conserved and divergent features that explain functional specialization. Structural studies in different conformational states (substrate-bound, open, closed) would be particularly valuable for understanding the transport cycle.

Molecular dynamics simulations based on structural data could provide insights into how SLC25A14 interacts with the lipid bilayer, how substrates move through the transport channel, and how potential regulatory molecules affect protein function. Structure-guided mutagenesis studies could then validate computational predictions and identify residues critical for transport activity or uncoupling function.

What emerging technologies could accelerate research on SLC25A14 and related mitochondrial carriers?

Several cutting-edge technologies have the potential to drive significant advances in SLC25A14 research. CRISPR/Cas9-based approaches for precise genome editing allow for creation of physiologically relevant models with specific mutations or tagged endogenous SLC25A14, enabling studies under native expression conditions. CRISPR activation (CRISPRa) and interference (CRISPRi) systems provide alternative approaches for modulating SLC25A14 expression without permanent genetic alterations.

Advanced imaging techniques such as super-resolution microscopy can provide unprecedented insights into SLC25A14 localization within mitochondria and potential colocalization with other mitochondrial proteins. Live-cell imaging with fluorescent protein fusions or specific probes can track dynamic changes in SLC25A14 distribution or activity in response to various stimuli.

Single-cell technologies, including single-cell RNA sequencing and single-cell proteomics, could reveal cell-type specific expression patterns and functions of SLC25A14, particularly important in heterogeneous tissues like the brain. Metabolic flux analysis using stable isotope labeling coupled with mass spectrometry offers powerful approaches for determining how SLC25A14 affects specific metabolic pathways and substrate utilization.

Organoid models derived from stem cells could provide more physiologically relevant systems for studying SLC25A14 function in complex, three-dimensional tissue environments that better recapitulate in vivo conditions than traditional cell culture systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.