Recombinant Human Brain protein I3 (BRI3)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To specify a tag type, please inform us, and we will prioritize its development.
The tag type is determined during production. To specify a tag type, please inform us, and we will prioritize its development.
Synonyms
BRI3; Brain protein I3; pRGR2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
BRI3
Target Protein Sequence
MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPPPPPYPYLVTGIPTHHPRVYNIH
SRTVTRYPANSIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNC
GATFA
Uniprot No.
Target Background
Function
BRI3 (Brain protein I3) participates in tumor necrosis factor-alpha (TNF)-induced cell death and may be a target of Wnt/β-catenin signaling in the liver.
Gene References Into Functions
- In hepatocellular carcinoma cells, BRI3 is a target of WNT signaling. PMID: 20538055
- An X-ray data set of a ligandin recombinant fusion protein was collected to 1.6 Å resolution using synchrotron radiation. PMID: 16508092
- BRI3 may play a role in neuronal differentiation. PMID: 18452648
- BRI3 inhibits amyloid protein precursor processing by blocking access of α- and β-secretases. PMID: 19366692
- BRI3 RNA expression is lower in stage 3 colon cancer compared to stage 2, and is part of an 8-gene signature differentiating colon cancer stages. PMID: 17390049
Database Links
Protein Families
BRI3 family
Subcellular Location
Lysosome membrane; Multi-pass membrane protein.; [Isoform 1]: Cytoplasm, perinuclear region.; [Isoform 2]: Cytoplasm. Nucleus.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
