Recombinant Human C-C chemokine receptor type 3 (CCR3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
CCR3; CMKBR3; C-C chemokine receptor type 3; C C CKR3; C-C CKR-3; CC-CKR-3; CCR-3; CCR3; CKR 3; CKR3; Eosinophil eotaxin receptor; CD antigen CD193
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLLGNVVVVMILI KYRRLRIMTNIYLLNLAISDLLFLVTLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSE IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIVTWGLAVLAALPEFIFYETEELFEE TLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKTLLRCPSKKKYKAIRL IFVIMAVFFIFWTPYNVAILLSSYQSILFGNDCERSKHLDLVMLVTEVIAYSHCCMNPVI YAFVGERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIVF
Uniprot No.

Target Background

Function
Recombinant Human C-C chemokine receptor type 3 (CCR3) is a receptor for C-C type chemokines. It binds and responds to various chemokines, including CCL11, CCL26, CCL7, CCL13, RANTES (CCL5), and CCL15, subsequently transducing a signal by increasing intracellular calcium ion levels. CCR3 also functions as a potential receptor for NARS1 and acts as an alternative coreceptor with CD4 for HIV-1 infection.
Gene References Into Functions
  1. Familial hypercholesterolemia (FH)-derived macrophages (MACs) exhibit an inflammatory phenotype marked by upregulated CCR3, CCR4, and CXCR1 expression, controlled by miR-505-3p. This suggests a chronic inflammatory state in FH innate immunity cells, not reversed by standard lipid-lowering treatments. PMID: 29457550
  2. CCR3 exists as a mixture of monomers and dimers under near-physiological conditions. The monomeric form is the minimal functional unit for cellular signal transduction. Agonists increase dimer and oligomer formation at high concentrations, while antagonists do not affect oligomeric state. Monomeric CCR3 shows a stronger chemotactic response in migration assays. PMID: 28994588
  3. CCR3, a CCL28 receptor, is highly expressed in lung adenocarcinoma vascular endothelial cells and is targeted by CCL28 to regulate angiogenesis. PMID: 27250766
  4. CCL11-CCR3 binding is implicated in glioblastoma multiforme (GBM) progression. PMID: 27119233
  5. High CCR3 mRNA expression correlates with improved relapse-free survival in luminal A/B breast cancer. PMID: 27086913
  6. CCR3 expression was investigated on dispersed synovial tissue and peripheral blood cells in rheumatoid arthritis. PMID: 27495116
  7. Chemokine receptors CCR3 and CCR4, and CCL28, play key roles in oral wound healing by promoting fibroblast proliferation, migration, IL-6 and HGF secretion, and reducing TIMP-1 secretion. PMID: 28387445
  8. Simvastatin inhibits IL-5-induced CCR3 expression and eosinophil chemotaxis via the mevalonate pathway. PMID: 27275740
  9. Approximately 4.5% of dispersed osteoarthritis (OA) synovial tissue cells are CCR3+ cells. PMID: 26409848
  10. The rs917997 polymorphism of the IL-18 receptor accessory protein and the rs6441961 polymorphism of CCR3 are potential risk factors for celiac disease in European populations. PMID: 26289103
  11. Periprostatic adipocytes promote prostate cancer progression in obesity by secreting CCL7, which stimulates CCR3-expressing tumor cells. PMID: 26756352
  12. The structure of CCL11 bound to the sulfated N-terminal region of CCR3 reveals that sulfation enhances receptor activity. PMID: 25450766
  13. CCL28-CCR3 interactions are involved in the homing of CD4+ T cells to the upper airways. PMID: 24917456
  14. RANTES and IP-10 play a dominant role in recruiting CXCR3(+)CCR5(+) cells to tubercular lesions. PMID: 23643185
  15. CCR3-mediated communication between epidermis and dermis may modulate tissue remodeling in atopic dermatitis. PMID: 23702389
  16. Retinoic acids upregulate functional eosinophil-driving receptor CCR3. PMID: 23742077
  17. CCR3 shows good sensitivity (83%) but low specificity (59%) in identifying histamine-releasing activated basophils. PMID: 23955446
  18. Chemokine CCR3 ligand-binding peptides were derived from a random phage-epitope library. PMID: 23183094
  19. Different GATA factors regulate CCR3 transcription in allergic inflammatory cells in a cell type-specific manner. PMID: 23636060
  20. The rs3091250 SNP in CCR3 is associated with age-related macular degeneration. PMID: 23566847
  21. CCR3 is strongly expressed by airway smooth muscle cells in vitro and in vivo. Protection against cell death by CCR3 activation depends on p42/44 MAPK but does not affect caspase 3-mediated apoptosis. PMID: 22702503
  22. Methylation of CpG sites at GATA elements in the regulatory regions fine-tunes CCR3 transcription. PMID: 22217447
  23. Cross-talk between CCR3 and VEGF signaling is implicated in choroidal neovascularization in age-related macular degeneration. PMID: 21917937
  24. Pulmonary epithelial CCR3 is involved in lipopolysaccharide-induced lung inflammation by mediating IL-8 release. PMID: 21660963
  25. CCL11 and CCR3 mRNA expression are significantly higher in anaplastic large cell lymphoma (ALCL) lesional skin compared to normal skin. PMID: 21406396
  26. Leukocytes from children with infectious mononucleosis express higher CCR3 and lower CCR5 levels. PMID: 21280323
  27. GATA-1 regulates CCR3 transcription by interacting with multiple GATA sites in the CCR3 gene regulatory region. PMID: 21041734
  28. CCR3 expression is increased in T cells and the colon in ulcerative colitis compared to other inflammatory bowel diseases and controls. PMID: 21077277
  29. CCR3 is differentially expressed on inflammatory cells in rheumatoid arthritis, while eotaxin-2 is differentially expressed in active disease. PMID: 20659406
  30. CCR3 genetic polymorphisms may contribute to aspirin-exacerbated respiratory disease and may serve as a genetic marker for differentiating aspirin hypersensitivity phenotypes. PMID: 20022477
  31. Eotaxin and CCR3 interactions regulate the Th2-dominant tumor microenvironment in cutaneous T-cell lymphoma. PMID: 20505746
  32. The T17C CCR3 polymorphism is associated with asthma bronchoconstriction and severity but not atopy. PMID: 20726325
  33. AZD3778's potential use in allergic rhinitis and the role of eosinophils in allergic rhinitis symptomatology are discussed. PMID: 20144207
  34. Data suggest a role of dendritic cells (DCs) in the differential regulation of CCR3 and CCR4 on CD4+ T cells from house dust mite (HDM)-sensitive and non-atopic asthmatics after Der p 1 exposure. PMID: 20364559
  35. Plasma eotaxin levels and CCR3 expression on CD4+ T cells are higher in allergic patients than in controls across different allergy types. PMID: 20306659
  36. Alanine scanning mutagenesis of CCR3 reveals that the three intracellular loops are essential for functional receptor expression. PMID: 11920572
  37. Bronchial CCR3 expression is upregulated during chronic bronchitis exacerbations. PMID: 11991282
  38. CCR3 is absent from the testes. PMID: 11994538
  39. A downstream promoter element-dependent, general transcription control mechanism is conserved between Drosophila and human CCR3 genes. PMID: 12079287
  40. CCR3 is expressed by dendritic cells (DCs) differentiated from blood monocytes, skin-emigrating DCs, and DCs derived from CD34+ hematopoietic precursors. PMID: 12218106
  41. CCR3 and its ligand eotaxin/CCL11 play a role in recruiting and retaining CD30+ malignant T cells in the skin. PMID: 12393570
  42. CCR3 mobilizes to the surface of human mast cells and potentiates IgE-dependent IL-13 production. PMID: 12654630
  43. Eosinophil CCR3 expression in atopic individuals does not correlate with atopy or serum IgE levels. PMID: 12794150
  44. Eosinophil responses mediated by chemokines acting at CCR3 are regulated by CXCR3 ligands and CCL11 sequestration by CXCR3-expressing cells. PMID: 12884299
  45. Eotaxin/CCL11 ligation of CCR3 induces apoptosis in IL-2- and IL-4-stimulated B cells but does not affect chemotaxis or cell adhesion. PMID: 12902471
  46. A specific single nucleotide polymorphism in CCR3 is not associated with atopic dermatitis in Japanese populations. PMID: 14581140
  47. Eotaxin's two N-terminal motifs cooperate with other regions to bind and activate CCR3. PMID: 14733956
  48. The role of the epidermal growth factor receptor in CCR3 signaling was examined. PMID: 15219825
  49. Multiple residues on multiple extracellular domains of human CCR3 are important for HIV-1 coreceptor activity. PMID: 15476879
  50. Restoration of CRTH2/CCR3 expression may indicate optimal recovery after septic shock. PMID: 15507393
Database Links

HGNC: 1604

OMIM: 601268

KEGG: hsa:1232

STRING: 9606.ENSP00000441600

UniGene: Hs.506190

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
In eosinophils as well as trace amounts in neutrophils and monocytes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.