Recombinant Human C-C chemokine receptor type 5 (CCR5)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human C-C Chemokine Receptor Type 5 (CCR5)

Recombinant Human C-C chemokine receptor type 5 (CCR5) is a protein that plays a crucial role in the immune system, particularly in the trafficking of immune cells and as a co-receptor for HIV entry into host cells. CCR5 is a member of the G protein-coupled receptor family and is expressed on the surface of various immune cells, including T cells and macrophages.

Structure and Function of CCR5

The CCR5 protein consists of 352 amino acids, with a molecular weight of approximately 40.6 kDa. It features seven transmembrane domains, three extracellular loops, and three intracellular loops, along with a cytoplasmic tail . The receptor is involved in chemokine signaling, which is essential for directing immune cells to sites of inflammation. CCR5's role in HIV infection is significant, as it serves as a primary co-receptor for macrophage-tropic HIV strains during the early stages of infection .

Role in HIV Infection

CCR5's involvement in HIV infection is well-documented. The receptor facilitates the entry of HIV into host cells by acting as a co-receptor alongside CD4 . Individuals with a mutation in the CCR5 gene, known as CCR5 delta-32, have a reduced susceptibility to HIV infection. This mutation leads to a truncated protein that is not expressed on the cell surface, thereby preventing HIV from using CCR5 for entry .

CCR5 Delta-32 Mutation

The CCR5 delta-32 mutation is a 32-base pair deletion in the CCR5 gene. This mutation results in a non-functional receptor that cannot be expressed on the cell surface, rendering individuals homozygous for this mutation resistant to HIV infection . A notable case involved a patient who received a bone marrow transplant from a donor homozygous for the CCR5 delta-32 mutation and subsequently became HIV-negative .

Expression and Regulation

CCR5 expression is highly variable and can be influenced by several factors, including inflammation and genetic polymorphisms. In HIV-infected individuals, CCR5 promoter polymorphisms have been linked to disease progression by affecting CD4 T cell apoptosis . The expression of CCR5 is also up-regulated in certain conditions, such as acute HIV syndrome .

Research Findings and Applications

Recent studies have explored the role of CCR5 in various diseases beyond HIV, including neurological conditions and cancer. For instance, CCR5 has been implicated in glioblastoma, where it is associated with poor prognosis . Additionally, research on CCR5's role in microglial biology suggests its involvement in neurological phenotypes .

Data Table: Key Features of CCR5

FeatureDescription
Protein Structure352 amino acids, 7 transmembrane domains, 3 extracellular loops, 3 intracellular loops
Molecular WeightApproximately 40.6 kDa
Role in HIVActs as a co-receptor for HIV entry into host cells
CCR5 Delta-32 Mutation32-base pair deletion leading to non-functional receptor, conferring resistance to HIV
Expression RegulationInfluenced by inflammation, genetic polymorphisms, and disease states
Disease AssociationsHIV, neurological conditions, glioblastoma

Product Specs

Buffer
Lyophilized from Tris/PBS-based buffer containing 6% Trehalose.
Form
Available in both liquid and lyophilized powder formats.
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement in the order notes, and we will accommodate your request.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Synonyms
CCR5; CMKBR5; C-C chemokine receptor type 5; C-C CKR-5; CC-CKR-5; CCR-5; CCR5; CHEMR13; HIV-1 fusion coreceptor; CD antigen CD195
Datasheet & Coa
Please contact us to get it.
Expression Region
1-352aa
Mol. Weight
43.9 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Cancer
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
CCR5 is a receptor for various inflammatory CC-chemokines, including CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES. Upon chemokine binding, CCR5 transduces a signal by elevating intracellular calcium levels. It may play a role in controlling granulocytic lineage proliferation or differentiation. CCR5 participates in T-lymphocyte migration to infection sites by serving as a chemotactic receptor. In the context of microbial infections, CCR5 acts as a coreceptor (along with CD4 as the primary receptor) for human immunodeficiency virus-1 (HIV-1).
Gene References Into Functions
  1. Conditioned media or microparticles released from obese omental adipose tissue increased CD16 and CCR5 expression on CD14(+)CD16(-) monocytes, enhancing their migratory capacity towards the conditioned media from obese omental adipose tissue. PMID: 27677832
  2. Inhibition of protein kinase phosphorylation by staurosporine treatment prevents the capture of the CCR5 signalosome into early endosomes. This suggests that phosphorylation events are crucial for forming stable receptor-beta-arrestin2 complexes, involving ubiquitination of beta-arrestin2 and sustained phosphorylation of ERK1, which accumulate in early endosomes. PMID: 29283386
  3. Data suggests that exposure of myeloid cells to methamphetamine (Meth) in the presence of HIV peptides, such as Tat, may influence the number of HIV targets by modulating CCR5 expression through both dopamine-dependent and -independent mechanisms. PMID: 29944719
  4. Using the CPRC prostate cancer model, we demonstrate that endothelial cells secrete a significant amount of CCL5, inducing autophagy by suppressing AR expression in prostate cancer cell lines. Consequently, increased autophagy accelerates focal adhesions proteins disassembly, promoting prostate cancer invasion. Inhibition of both CCL5/CCR5 signaling and autophagy significantly reduces metastasis in vivo. PMID: 30200999
  5. Evidence indicates that CCR5 plays a crucial role in bone-destructive conditions through the functional regulation of osteoclasts. PMID: 29263385
  6. CCR5 is critically involved in the recruitment and activation of myeloid-derived suppressor cells within the melanoma microenvironment. PMID: 29089297
  7. These findings highlight the potential involvement of CCR5 signaling in central nervous system inflammation and damage associated with multiple sclerosis. PMID: 29729320
  8. As patients with and without CCR5Delta32 mutations exhibited similar histological activity, fibrosis stage, and CCR5 tissue expression, the authors reasonably conclude that this CCR5 mutation is not significantly involved in the pathogenesis of chronic hepatitis C. PMID: 29664712
  9. This study demonstrates that CCR5 promoter polymorphisms correlate with CD4 T cell loss, possibly by regulating CD4 T cell apoptosis in HIV patients. PMID: 28331180
  10. Results suggest that monocytes from Crohn's disease patients in remission produced high levels of CSF-1, upregulating CCR5 expression. Consequently, monocytes differentiated under these conditions exhibit a characteristic phenotype and reduced production of inflammatory cytokines. PMID: 28273887
  11. The findings provide genetic and epidemiological evidence for an association of UGT1A and CCR5 polymorphisms with hepatitis B virus infection in Chinese Yi and Yao populations. PMID: 29239247
  12. The authors also demonstrated that Treg migration to the tumor microenvironment is mediated by CCR5, and these cells promote tumor growth by inhibiting antitumor cells, such as cytotoxic CD8(+) T cells. PMID: 28904130
  13. These data indicate that cardiac surgery influences the expression of CD162, CD166, and CD195, and the intensity of the immune system response, as reflected in the change in CD162, CD166, and CD195 expression, varies depending on the surgical technique used. PMID: 27625334
  14. The interaction between CCR5 and its ligands promotes the proliferation of CCR5(+) polymorphonuclear-myeloid-derived suppressor cells in the bone marrow. PMID: 29166611
  15. The CCR5Delta32 allele is not associated with susceptibility to HIV-1 infection in the Iranian population. PMID: 29209099
  16. Engineered CCR5Delta32/Delta32 mutations conferred CD4+ U87 cells with resistance against HIV1 infection; this site-specific, size-controlled, and homozygous DNA deletion technique successfully induced precise genomic editing. PMID: 29115572
  17. KLF5-regulating cancer-associated fibroblasts affect gastric cancer cell progression by CCL5 secretion and activation of CCR5. PMID: 28934010
  18. The CCR5Delta32 mutation is not associated with acute graft-versus-host disease. PMID: 28862353
  19. CCR5 is involved in the development of new antibody-based therapeutics. PMID: 28008933
  20. These results confirm the protective role of CCR5Delta32 and extend it to long-term survival in a large cohort of HIV-infected patients. Beyond its antiviral effect, CCR5Delta32 enhanced the long-term survival of patients on combined antiretroviral therapy (cART). PMID: 29221798
  21. This study showed that individuals with the CCR5/CCR5 genotype and simultaneously the CCR5-59029 AA or AG genotypes have a greater risk of developing ocular toxoplasmosis, which may be associated with a strong and persistent inflammatory response in ocular tissue. PMID: 29221851
  22. The protective CCR5-Delta32 allele appears to be rarely present in Saudi Arabia. PMID: 28731615
  23. These data highlight the important role of CCR5 in the onset of acute coronary syndrome and suggest this receptor as a marker of cardiovascular risk. PMID: 28276569
  24. We observed an overall protective effect associated with the presence of the CCR5Delta32 allele against rheumatoid arthritis (RA) susceptibility, evident in cities with a lower African genetic component. Our results emphasize the importance of assessing the influence of CCR5 under different genetic backgrounds. PMID: 28082621
  25. Results suggest that the CCR5 gene and its product might play a role in the pathogenesis of Crimean-Congo hemorrhagic fever infection. PMID: 28547880
  26. The interplay between chemokine receptor CCR5 expression, cancer stem cells, and hypoxia. PMID: 28693495
  27. Genetic association studies in the Polish population: Data suggest that the CCR5-delta32 gene polymorphism is associated with type 1 diabetes (T1D) and increases the risk of celiac disease and autoimmune thyroid disorders in patients with T1D; the risk of celiac disease or autoimmune thyroiditis in carriers of the 32-bp deletion is more than threefold higher than for non-carriers. PMID: 27894748
  28. Differential distribution of the viral reservoir compartment in CCR5((WT/Delta32)) patients with perinatal HIV infection. PMID: 28042001
  29. The donor CCR5 -2086A/A genotype was associated with a lower incidence of grades 3-4 acute GVHD, which did not improve survival outcomes. These findings suggest that the recipient CCR5 -2086A/A genotype affects the induction of the graft-versus-tumor effect without augmenting the development of GVHD. PMID: 28487238
  30. Searched for the relationship between single nucleotide polymorphism in the promoter region of the CD209, IL-10, IL-28, and the 32 base pair deletion in the CCR5 coding region (Delta 32) with human predisposition to the development of various clinical presentations of tick-borne encephalitis. PMID: 28894041
  31. Deficiency of CCR5 exacerbates alcoholic fatty liver disease by inducing hepatic inflammation through pro-inflammatory cytokines and chemokines and oxidative stress. PMID: 27859576
  32. The rs1800024 polymorphism is significantly associated with the occurrence risk of psoriasis vulgaris in the Chinese population. PMID: 29145242
  33. CCR5-tropic HIV infection is limited to more differentiated progenitor cells with life spans that are less well understood. PMID: 28732051
  34. Data provide evidence that CCR5 activation mediates CCL5 enhancement of the proliferation and invasive capacity of human breast cancer cell lines. PMID: 27335323
  35. The CCR5-Delta32 polymorphism is associated with type 1 diabetes. PMID: 27619405
  36. CCR52 genetic variants were not associated with the risk of atherosclerotic coronary heart disease and glucometabolic traits. PMID: 27013693
  37. No sickle cell disease patients presented the CCR5Delta32 deletion. PMID: 28671257
  38. This review discusses the role of CCR5 in the recruitment and activation of myeloid-derived suppressor cells in melanoma. PMID: 28382399
  39. CCR5 is highly expressed in active inflammatory bowel disease and has a positive correlation with lymphocyte grade and a negative correlation with the expression of beta-arrestin2. PMID: 28140695
  40. This study shows that the dominant signature of resistance to HIV infection in this cohort of exposed but uninfected individuals was lower T-cell CCR5 expression. PMID: 28398593
  41. The level of IFNAR1, IFNAR2, and CCR5 mRNA expression was found to be significantly lower in responders than non-responders. Our results highlight the significance of IFNAR and CCR5 genes in multiple sclerosis risk and the response to IFN-b therapy. PMID: 27346865
  42. Env regions that respond to CCR5 binding were located in the gp120 alpha1 helix and in the gp41 HR1 heptad repeat and membrane-proximal external region. PMID: 28521215
  43. A frameshift mutation in CCR5 was associated, but not significantly, with sporadic inclusion body myositis. PMID: 28086002
  44. The study revealed that while HIV-1 gp120 and Staph aureus LukED both target CCR5, they bind to different regions of the receptor, highlighting the divergence of the pathogens. PMID: 27965453
  45. Genetic variation of the CCR5 gene demonstrates a possible association with hypertension, diabetes mellitus, and atherosclerosis comorbidity in patients treated with hemodialysis. PMID: 27118566
  46. Findings indicate the importance of chemokine (CC motif) ligand 5 (CCL5) genetic variability and the CCL5-CCR5 (CC chemokine receptor 5) axis on susceptibility to HCV infection. PMID: 27304910
  47. The transferred nuclear Overhauser effect (TRNOE) crosspeaks in the ternary complex were assigned to specific Tyr protons in the human C-C chemokine receptor 5 (CCR5) chemokine receptor peptide and to methyl protons, predominantly of isoleucine residues, and also of leucine and/or valine residues of HIV-1 gp120 envelope protein. PMID: 27701820
  48. Intermolecular interactions of RANTES with its receptor CCR5 have been reported based on NMR spectroscopy measurements. PMID: 28052516
  49. Binding of J113863 to CCR2 or CCR5 also induced the recruitment of beta-arrestin 2, whereas UCB35625 did not. UCB35625 induced the chemotaxis of L1.2 cells expressing CCR2 or CCR5. In contrast, J113863 induced the migration of L1.2-CCR2 cells but antagonized the chemokine-induced migration of L1.2-CCR5 cells. PMID: 27895119
  50. The higher frequency of the CCR5 wild-type allele among leishmaniasis patients may suggest an increased risk of HIV infection and also support its facilitative role in Leishmania infection. PMID: 26970327

Show More

Hide All

Database Links

HGNC: 1606

OMIM: 601373

KEGG: hsa:1234

STRING: 9606.ENSP00000292303

UniGene: Hs.450802

Involvement In Disease
Diabetes mellitus, insulin-dependent, 22 (IDDM22)
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in spleen, thymus, in the myeloid cell line THP-1, in the promyeloblastic cell line KG-1a and on CD4+ and CD8+ T-cells. Medium levels in peripheral blood leukocytes and in small intestine. Low levels in ovary and lung.

Q&A

What is the genetic and structural basis of CCR5?

CCR5 is a G protein-coupled receptor belonging to the beta chemokine receptors family of integral membrane proteins. The human CCR5 gene is located on the short (p) arm at position 21 on chromosome 3 . Structurally, CCR5's C-terminal region is enriched in serines and threonines that provide phosphorylation sites for G-protein coupled receptor kinases . The protein contains distinct transmembrane domains, with specific regions crucial for ligand binding and receptor activation.

For researchers studying CCR5 structure-function relationships, it's important to note that amino acid modifications of CCR5 have significant consequences for both HIV infection and ligand binding affinity . The receptor contains key residues like M287 (position 7.43), Y108 (position 3.32), and E283 (position 7.39) that are critical for signaling functions, as mutations in these positions can reduce activation by approximately 40-70% without affecting ligand binding affinity .

What are the primary ligands for CCR5 and their binding mechanisms?

CCR5's cognate ligands include several chemokines:

  • CCL3 (also known as MIP-1α)

  • CCL4 (also known as MIP-1β)

  • CCL3L1

  • CCL5 (also known as RANTES)

The binding mechanism involves a complex interplay between the N-terminal domain of chemokines and specific receptor domains. Research has shown that CCR5 activation by chemokines like CCL5 involves interactions between the aspartic acid residue at positions 5 or 6 of the chemokine and the K26 residue (position 1.28) of CCR5 . This interaction stabilizes the extended hinge structure of the chemokine, which is crucial for receptor activation.

Experimental evidence indicates that mutations in the chemokine structure affect both signaling efficiency and binding affinity. For example, D5A and D5K mutations in [6P4]CCL5 decrease both maximum activation (Emax) by 30% and 60% respectively, while increasing EC50 approximately 5- to 10-fold .

How is CCR5 expressed in different cell types and what controls its regulation?

CCR5 is predominantly expressed on:

  • T cells

  • Macrophages

  • Dendritic cells

  • Eosinophils

  • Microglia

  • Specific subpopulations of breast or prostate cancer cells

Notably, CCR5 expression is selectively induced during cancer transformation and is not expressed in normal breast or prostate epithelial cells . Approximately 50% of human breast cancers express CCR5, primarily in triple-negative breast cancer subtypes .

The regulation of CCR5 expression is influenced by cell activation status. Studies have shown that the percentage of CD4+CCR5+ T-cells is higher (13.2%) in HIV-infected individuals compared to uninfected individuals (6.2%) . The activation state of CD4+ cells, as measured by HLA-DR expression, positively correlates with CCR5 expression levels .

What are the most effective methods for expressing and purifying recombinant human CCR5?

For producing functional recombinant human CCR5, researchers typically employ mammalian expression systems rather than bacterial ones due to the need for proper post-translational modifications.

Methodological Approach:

  • Expression System Selection:

    • Human embryonic kidney (HEK) cells and Chinese hamster ovary (CHO) cells have been demonstrated as effective systems for functional CCR5 expression

    • These cell types support proper protein folding and post-translational modifications

  • Vector Design Considerations:

    • Include affinity tags (e.g., His-tag, FLAG-tag) for purification

    • Consider including fluorescent protein fusions for trafficking studies

    • Codon optimization for mammalian expression

  • Purification Strategy:

    • Detergent solubilization (typically with mild detergents like DDM or LMNG)

    • Affinity chromatography using engineered tags

    • Size exclusion chromatography for final purification

  • Functional Validation:

    • Calcium flux activation assays in transfected cells to assess receptor function

    • Binding assays with labeled chemokines to confirm ligand interaction

    • Conformational antibody binding to verify proper folding

How can researchers effectively study CCR5 activation and signaling in experimental settings?

Several methodological approaches are available for investigating CCR5 activation and downstream signaling:

  • Calcium Flux Assays:

    • Widely used for assessing functional responses of CCR5 to ligands

    • HEK and CHO cells expressing CCR5 can be used to measure calcium mobilization upon stimulation

    • Enables determination of key pharmacological parameters (EC50 and Emax values)

  • Mutational Analysis:

    • Site-directed mutagenesis of key CCR5 residues (e.g., M287A, Y108A, E283A) to assess their role in signaling

    • Mutations in these positions reduce signaling without affecting chemokine affinity

  • Chemokine Variant Testing:

    • Modifications to chemokine structure (e.g., D5A and D5K mutations in [6P4]CCL5) affect both signaling efficiency and binding affinity

    • Truncation studies show that variants lacking the first few N-terminal residues (CCL5 3-68, CCL5 4-68) have reduced receptor affinity and diminished functional responses

  • G-Protein Coupling Assessment:

    • BRET (Bioluminescence Resonance Energy Transfer) assays to measure G-protein dissociation

    • Analysis of downstream signaling using phospho-specific antibodies against key signaling molecules

What are the optimal approaches for studying CCR5 genetic variants and their functional consequences?

Research into CCR5 genetic variants, particularly the Δ32 mutation, requires specific methodological considerations:

  • Variant Identification Strategy:

    • Extract CCR5 missense and loss-of-function variants from genomic databases including:

      • gnomADv2.1

      • COSMIC

      • Bravo for TOPmed variants

      • ClinVar

      • Geno2MP

  • Functional Prediction Analysis:

    • Assess variants using multiple prediction tools:

      • PolyPhen2

      • Provean

      • SIFT

      • Align-GVGD

    • Calculate impact scores incorporating functional prediction, codon selection, conservation, and allele frequency data

  • Experimental Validation Methods:

    • Site-directed mutagenesis to recreate variants

    • Cell-based functional assays to assess:

      • Receptor expression levels

      • Ligand binding affinity

      • Calcium signaling capacity

      • Chemotactic responses

      • HIV co-receptor function

  • Population Analysis Considerations:

    • Different populations have varying frequencies of CCR5 variants

    • The Δ32 mutation appears to have arisen once in the last millennium and increased to approximately 10% allele frequency in European populations due to strong selective pressure

How does CCR5 function as a co-receptor for HIV-1 and what are the implications for therapeutic development?

CCR5 serves as a primary co-receptor for macrophage-tropic (M-tropic) strains of HIV-1, facilitating viral entry into host cells. Understanding this mechanism has significant implications for therapeutic development.

Mechanism of HIV Co-Receptor Function:

CCR5 functions as a co-receptor alongside CD4 for HIV-1 entry. The virus initially binds to CD4, inducing conformational changes in the viral envelope protein that enable subsequent interaction with CCR5, ultimately leading to membrane fusion and viral entry.

The discovery that homozygous carriers of the CCR5-Δ32 mutation display near-complete resistance to HIV infection, regardless of exposure, provided a critical insight into the essential role of CCR5 in HIV pathogenesis . This finding has directly influenced therapeutic strategies targeting CCR5.

Therapeutic Approaches Targeting CCR5:

  • Small Molecule CCR5 Antagonists:

    • Prevent HIV binding to CCR5 by inducing conformational changes in the receptor

    • Current challenges include optimizing pharmacokinetics and minimizing side effects

  • Gene Editing Approaches:

    • The case of an HIV-positive individual who received bone marrow transplant from a donor homozygous for CCR5-Δ32 and subsequently became HIV-negative demonstrates proof-of-concept

    • CRISPR-Cas9 and other gene editing tools are being investigated to recreate CCR5-Δ32 phenotype in patients

  • Experimental Considerations for Researchers:

    • Assessment of off-target effects remains critical given CCR5's roles in inflammation and immune function

    • Long-term monitoring for unexpected consequences is essential as CCR5 has functions beyond HIV co-receptor activity

What role does CCR5 play in cancer biology and what research methods best elucidate these functions?

Recent research has revealed important roles for CCR5 in cancer biology, particularly in breast and prostate cancers:

CCR5 Expression in Cancer:

  • Expression is selectively induced during cancer transformation

  • Not expressed in normal breast or prostate epithelial cells

  • Approximately 50% of human breast cancers express CCR5, primarily in triple-negative breast cancer

Functional Roles in Cancer:

  • CCR5 inhibitors block migration and metastasis of CCR5-expressing cancer cells

  • CCR5 is expressed in a subset of cancer cells with cancer stem cell characteristics

  • These cells drive therapy resistance

  • CCR5 inhibitors enhance the efficacy of current chemotherapy by increasing cell death

Recommended Research Methodologies:

  • Expression Analysis:

    • Immunohistochemistry and flow cytometry to quantify CCR5 expression in tumor tissues and cancer cell lines

    • Single-cell RNA sequencing to identify CCR5-expressing subpopulations

  • Functional Assays:

    • Migration and invasion assays with CCR5 inhibitors

    • Chemotaxis assays toward CCR5 ligands

    • Cancer stem cell marker co-expression analysis

  • Therapeutic Response Assessment:

    • Combination studies with CCR5 inhibitors and standard chemotherapeutics

    • Patient-derived xenograft models to evaluate CCR5 targeting in vivo

How do CCR5 polymorphisms, particularly Δ32, affect immune function beyond HIV resistance?

The CCR5-Δ32 mutation has implications beyond HIV resistance, affecting broader immune function and disease outcomes:

Immune System Effects:

  • CCR5 enhances T-cell co-stimulation and cytokine release from CD4+ T-cells

  • CCR5 ligands augment T-cell activation responses and enhance production of antigen-specific T-cells

  • During inflammation, CCR5 expression is up-regulated in CD8+ cells, facilitating migration to sites of CD4+ T-cell and dendritic cell interactions

Disease Associations Beyond HIV:

  • CCR5 has been implicated in regulating Staphylococcus aureus infection

  • It plays a role in stroke recovery

  • It affects outcomes in fatal graft complications

Research Approaches for Investigating Δ32 Effects:

  • Immunophenotyping:

    • Compare immune cell subsets and activation markers between wild-type, heterozygous, and homozygous Δ32 individuals

    • Analyze cytokine production profiles in response to various stimuli

  • Infection Models:

    • Challenge models using pathogens beyond HIV

    • Assess differences in pathogen clearance and inflammatory responses

  • Population-Based Studies:

    • Investigate associations between CCR5 genotype and outcomes in various inflammatory and infectious diseases

    • Apply principles of population genetics to understand selective pressures that influenced Δ32 frequency

What are the critical structural domains of CCR5 for ligand binding and receptor activation?

Understanding the structure-function relationship of CCR5 is crucial for rational drug design and therapeutic development. Several critical domains have been identified:

Key Structural Elements:

  • N-Terminal Domain:

    • Important for initial chemokine recognition

    • Interacts with the core domain of chemokines

  • Transmembrane Helices:

    • TM1 contains K26 (position 1.28), which forms a salt bridge with aspartic acid residues in chemokine ligands

    • TM3 contains Y108 (position 3.32), critical for signaling

    • TM6 and TM7 undergo conformational changes during receptor activation

    • TM7 contains M287 (position 7.43) and E283 (position 7.39), both crucial for signaling functions

  • Extracellular Loops:

    • Form the chemokine recognition site 2 (CRS2)

    • Critical for selective binding of different chemokines

  • C-Terminal Region:

    • Enriched in serines and threonines that provide phosphorylation sites for G-protein coupled receptor kinases

    • Important for receptor desensitization and internalization

Activation Mechanism:
The binding of chemokines to CCR5 induces conformational changes connecting the receptor activation pathways primarily through TM7 and TM6. The W248 residue (position 6.48) lies at the center of these conformational changes, playing a crucial role in signal transduction .

How do specific amino acid modifications affect CCR5 function and ligand interactions?

Amino acid modifications of CCR5 have significant impacts on receptor function and ligand interactions:

Impact of Receptor Mutations:

MutationEffect on SignalingEffect on BindingResearch Method
M287A (7.43A)~40-70% reduction in EmaxNo effect on EC50Ca2+ flux assays in HEK cells
Y108A (3.32A)~40-70% reduction in EmaxNo effect on EC50Ca2+ flux assays in HEK cells
E283A (7.39A)~40-70% reduction in EmaxNo effect on EC50Ca2+ flux assays in HEK cells

Data derived from calcium flux activation assays in HEK and CHO cells expressing CCR5

Impact of Ligand Modifications:

[6P4]CCL5 VariantEffect on SignalingEffect on BindingMechanism
Wild-typeBaselineBaselineD5 forms salt bridge with K26
D5A30% reduction in Emax~5-fold increase in EC50Loss of favorable interaction with K26
D5K60% reduction in Emax~10-fold increase in EC50Repulsive interaction with K26
N-terminal truncationsReduced efficacyReduced affinityLoss of contacts at CCR5 CRS2 region

Data based on functional and binding studies with CCL5 variants

These structure-function studies provide critical insights for researchers designing CCR5-targeted therapeutics or investigating natural receptor variants.

What are the evolutionary implications of CCR5 structure conservation across species?

The evolutionary analysis of CCR5 provides important insights into protein function and the origins of variants like Δ32:

Evolutionary Conservation:

  • CCR5 belongs to the CC chemokine receptor family, which shows varying degrees of homology

  • Homology within this family may provide compensatory mechanisms for some CCR5 functions in individuals carrying Δ32 or other variants

  • The extent of functional compensation by other family members remains incompletely understood

Δ32 Mutation Origin and Selective Pressure:

  • Molecular evolutionary theory suggests that the CCR5-Δ32 mutation occurred only once in the last millennium

  • Strong selective pressure drove its frequency to approximately 10% in European populations relatively recently

  • Several hypotheses exist regarding the nature of this selective pressure, including protection against historical pandemics

Research Approaches for Evolutionary Studies:

  • Comparative Genomics:

    • Cross-species comparison of CCR5 sequence and structure

    • Analysis of functional conservation versus divergence

  • Population Genetics:

    • Analysis of CCR5 allele frequencies across global populations

    • Assessment of signatures of selection in genomic regions surrounding CCR5

  • Functional Redundancy Assessment:

    • Evaluate compensation by other chemokine receptors in CCR5-deficient models

    • Compare phenotypes across species with varying CCR5 structures

How can researchers investigate CCR5's role in neurological conditions and stroke recovery?

Recent findings have implicated CCR5 in neurological processes, particularly in stroke recovery:

Current Understanding:

  • CCR5 has been identified as a factor affecting recovery from stroke

  • The receptor is expressed on microglia, the resident immune cells of the brain

  • CCR5 may influence neuroinflammatory processes that impact neurological outcomes

Suggested Research Approaches:

  • Animal Models:

    • Compare stroke outcomes in CCR5-deficient versus wild-type animals

    • Assess post-stroke inflammatory responses and neural repair mechanisms

    • Test CCR5 antagonists as potential treatments to promote recovery

  • Molecular Mechanisms:

    • Investigate CCR5-mediated signaling in microglia and its impact on neuroinflammation

    • Explore interactions between CCR5+ immune cells and neural progenitors during recovery

    • Analyze gene expression changes in CCR5+ cells in neural tissues after injury

  • Clinical Correlations:

    • Examine associations between CCR5 genotypes and stroke recovery outcomes in patients

    • Consider CCR5 expression as a biomarker for recovery potential

    • Design pilot studies of CCR5 antagonists in stroke recovery

What methodologies are most effective for investigating CCR5 as a therapeutic target in inflammatory diseases?

Beyond HIV and cancer, CCR5 represents a potential therapeutic target in various inflammatory conditions:

Target Validation Approaches:

  • Disease-Specific Animal Models:

    • Evaluate CCR5 knockout or antagonist effects in models of:

      • Autoimmune diseases

      • Inflammatory bowel disease

      • Rheumatoid arthritis

      • Transplant rejection

  • Ex Vivo Human Tissue Studies:

    • Analyze CCR5 expression in affected tissues from patients

    • Test effects of CCR5 inhibition on inflammatory markers in patient-derived samples

    • Compare responses between different patient subgroups

  • Multiomics Integration:

    • Combine transcriptomics, proteomics, and metabolomics to map CCR5 signaling networks

    • Identify disease-specific alterations in CCR5 pathways

    • Discover potential combination therapy approaches

  • Translational Biomarkers:

    • Develop assays to predict and monitor response to CCR5-targeted therapies

    • Identify patient subgroups most likely to benefit from CCR5 modulation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.