Recombinant Human C-C chemokine receptor type 7 (CCR7)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human CCR7

CCR7, encoded by the CCR7 gene (Entrez Gene ID: 1236), mediates immune cell migration to secondary lymphoid organs via interactions with ligands CCL19 and CCL21 . Recombinant CCR7 retains the native receptor's seven transmembrane domains and signaling capabilities, making it indispensable for in vitro and in vivo studies of immune regulation, cancer metastasis, and drug discovery .

Gene and Protein Features

PropertyDetails
Gene SymbolCCR7
SynonymsBLR2, CD197, CMKBR7, EBI1
Protein Length378 amino acids (full-length)
Domains7 transmembrane helices, extracellular N-terminal, intracellular C-terminal
Post-Translational ModificationsGlycosylation sites at N-terminal domain

Recombinant CCR7 is expressed in systems like HEK293 cells or virus-like particles (VLPs), ensuring proper folding and post-translational modifications . For example, ACROBiosystems produces full-length CCR7 VLPs that mimic native membrane protein conformation .

Production and Purification

Recombinant CCR7 is generated using:

  • Expression Systems: HEK293 cells (for soluble forms) or VLPs (for membrane-bound forms) .

  • Tags: Variably tagged (e.g., His, Fc) to facilitate purification and detection .

  • Storage: Tris-based buffers with glycerol, stable at -80°C .

Signaling Mechanisms

  • Ligand Bias: CCL19 induces stronger β-arrestin recruitment and receptor internalization than CCL21 .

  • G Protein Activation: Both ligands activate Gαi/o proteins, but CCL21 shows weaker potency in calcium mobilization .

  • Cell-Type Dependency: Signaling outcomes vary across HEK293, U87, and CHO-K1 cells, highlighting context-specific effects .

Cancer Metastasis

  • CCR7 overexpression in tumors (e.g., melanoma, gastric cancer) promotes lymph node metastasis via:

    • Enhanced cell survival via PI3K/AKT/mTOR pathway .

    • Epithelial-mesenchymal transition (EMT) induction .

  • In A375 melanoma cells, CCR7 activation upregulates c-Fos, a metastasis-linked transcription factor .

Immune Regulation

  • Central Tolerance: CCR7 guides thymocytes to the thymic medulla for negative selection, preventing autoimmunity .

  • Dendritic Cell Maturation: CCR7 ligation upregulates MHC-II and co-stimulatory molecules (e.g., B7) .

Applications in Research

ApplicationUse CaseExample Study
Drug DiscoveryAllosteric antagonist screeningCrystal structure-guided Cmp2105 design
Cancer TherapeuticsMetastasis inhibition assaysMelanoma cell migration studies
Immunological AssaysT cell chemotaxis profilingβ-arrestin recruitment assays

Clinical Relevance

  • Autoimmune Diseases: Dysregulated CCR7 signaling correlates with rheumatoid arthritis and scleroderma .

  • Therapeutic Targeting: CCR7 antagonists (e.g., Cmp2105) show promise in blocking lymph node metastasis .

Challenges and Future Directions

  • Ligand Bias Complexity: Differential effects of CCL19 vs. CCL21 require cell-specific pathway profiling .

  • Delivery Optimization: VLPs improve immunogenicity but demand precise adjuvant strategies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to concentrate the contents at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preference for a particular tag type, please inform us, and we will prioritize its inclusion if feasible.
Synonyms
CCR7; CMKBR7; EBI1; EVI1; C-C chemokine receptor type 7; C-C CKR-7; CC-CKR-7; CCR-7; BLR2; CDw197; Epstein-Barr virus-induced G-protein coupled receptor 1; EBV-induced G-protein coupled receptor 1; MIP-3 beta receptor; CD antigen CD197
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-378
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
QDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYI YFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGM LLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSS EQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKV IIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPF LYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP
Uniprot No.

Target Background

Function
CCR7 is a receptor for the MIP-3-beta chemokine. It is believed to play a role in mediating the effects of Epstein-Barr virus (EBV) on B-lymphocytes or in normal lymphocyte functions.
Gene References Into Functions
  1. Research indicates that CCR7 promotes triple-negative breast cancer (TNBC) metastasis and may serve as a potential target for breast cancer diagnosis and treatment. PMID: 30032244
  2. High CCR7 expression has been linked to urinary bladder cancer metastasis. PMID: 28534984
  3. Studies suggest that CCL19/CCR7 contributes to the proliferation and invasion of endometrial stromal cells, potentially contributing to endometriosis pathogenesis by activating the PI3K/Akt pathway. PMID: 28856757
  4. Research findings demonstrate that the chemokines CCL19, CCL21, and CCR7 play crucial roles in bone destruction by enhancing osteoclast migration and resorption activity. This has been associated with rheumatoid arthritis pathogenesis. PMID: 28729639
  5. CXCR4, CCR7, VEGF-C, and VEGF-D expression might have synergistic effects on lymph node metastasis in patients with cervical cancer. PMID: 28535405
  6. Patients with acute graft-versus-host disease (aGvHD) received a higher percentage of CD4+CCR7+ T-cells in donor T-cells, while chronic GvHD (cGvHD) patients received a higher percentage of CD8+CCR7+ T-cells. Functional studies indicated that CCR7+ T-cells exhibit a greater potential for activation compared to CCR7- T-cells. PMID: 28112745
  7. CCL21/CCR7 interaction has been shown to activate epithelial-mesenchymal transition (EMT) in lung cancer cells via the ERK1/2 signaling pathway. PMID: 28487957
  8. The CCL21/CCR7 interaction allows natural killer (NK) cell adhesion to endothelial cells (ECs) and its reduction by hypoxia. PMID: 28416768
  9. Research indicates that miR-1275 positively regulates CCR7 expression in squamous cell carcinoma of the head and neck (SCCHN) through different mechanisms. PMID: 29278769
  10. Evidence suggests that CCR7 mediates EMT progression via the AKT pathway, highlighting its crucial role in breast cancer progression. PMID: 28378417
  11. Studies have reported an increased percentage of peripheral CCR7 T cells accompanied by endothelial dysfunction in patients with ankylosing spondylitis. PMID: 28421995
  12. Analysis of gene amplification and mRNA levels suggests that CCR7 expression in breast cancer correlates with better prognosis. PMID: 28930757
  13. CCR7 mediates TGF-beta1-induced MMP2/9 expression through NF-kappaB signaling. PMID: 28817313
  14. Leukocyte subsets exhibit distinct patterns of CCR7 sialylation, contributing to receptor signaling and fine-tuning chemotactic responses. PMID: 26819318
  15. Tumor microenvironment stimulation has been shown to down-regulate the migration of CCR7-expressing tumor cells towards CCL21 and inhibit the formation of directional protrusions towards CCL21 in a novel 3-dimensional hydrogel system. PMID: 26936935
  16. CCR7 expression levels in human tumors correlate with signatures of CD141(+) DC, intratumoral T cells, and improved clinical outcomes. PMID: 27424807
  17. A specific role for CCL21/CCR7 in promoting EMT and metastasis in CD133+ pancreatic cancer stem-like cells has been identified. PMID: 27505247
  18. This study demonstrated that CCR7 is overexpressed in CD4(-) CD8(-) thymocytes of myasthenia gravis patients. PMID: 26616645
  19. High tumoral CCR7 expression correlated with potential lymphatic involvement and unfavorable prognosis in metastatic renal cell carcinoma patients undergoing tyrosine kinase inhibitor treatment. PMID: 28114889
  20. Results indicate that upregulation of CCR7 promotes cell proliferation and inflammation in A549 non-small cell lung cancer cells. Conversely, silencing of CCR7 via siRNA treatment promotes cell apoptosis and suppresses the inflammatory response and TGF-beta1-induced EMT, potentially linked to NF-kappaB signaling. PMID: 28339080
  21. Down-regulating CCR7 expression in MG63 cells significantly inhibits cell proliferation, migration, invasion abilities, and induces cell apoptosis. PMID: 27916085
  22. Findings suggest that upregulation of rat CCR7 expression does not alter the phenotype, differentiation, or proliferation capacity of human adipose-derived stem cells (hASCs). However, it enables efficient migration of hASCs to rat secondary lymphoid organs. PMID: 28035134
  23. CCL21/CCR7 interaction contributes to the time-dependent proliferation of papillary thyroid carcinoma (PTC) cells by upregulating cyclin A, cyclin B1, and cyclin-dependent kinase 1 (CDK1) expression via the extracellular signal-regulated kinase (ERK) pathway associated with iodine. PMID: 27574129
  24. Findings suggest that the CCR7 gene locus harbors a polymorphism that modifies the risk of myocardial infarction in patients with coronary artery disease (CAD). Replication of this association in a prospective cohort of initially healthy individuals could be pursued. PMID: 27317472
  25. This study shows that plasmacytoid dendritic cells from rheumatoid arthritis patients have high expression levels of CCR7. PMID: 27421624
  26. This study suggests that NRP1 expression and lymphatic vessel density are independent factors that predict the risk of lymph node metastasis in squamous cell carcinoma (SCC) of the tongue. Meanwhile, the expression of VEGFC, VEGFR3, CCR7, and SEMA3E are non-independent predictive factors. PMID: 27666723
  27. High CCR7 expression is associated with gastric cancer. PMID: 26984468
  28. The CCR7 pathway up-regulates Twist expression via ERK and PI3K/AKT signaling to manage the epithelial-mesenchymal transition process in human pancreatic ductal adenocarcinoma. PMID: 26219899
  29. Constitutively expressed Siglec-9 inhibits LPS-induced CCR7 but enhances IL-4-induced CD200R expression in human macrophages. PMID: 26923638
  30. High CXCR4 expression in primary breast tumors (PTs) was associated with luminal A type tumor, suggesting a more favorable outcome. In contrast, CCR7 and FOXP3 expressions in PTs represented luminal B tumors, indicating more aggressive tumor behavior. Maspin expression did not differ between luminal types. PMID: 28011488
  31. Results indicated that CCR7 is overexpressed in gallbladder cancer tissues, and its expression correlates with staging and lymph node metastasis. PMID: 27009073
  32. CCL21/CCR7 induce VEGF-D up-regulation and promote lymphangiogenesis via the ERK/Akt pathway in lung cancer. PMID: 26884842
  33. The study demonstrated that down-regulation of CCR7 reduced proliferation, cell cycle progression, cell migration, and invasion in prostate cancer cells. PMID: 26722441
  34. Findings suggest that MUC1 plays a significant role in CCL21-CCR7-induced lymphatic metastasis and may serve as a therapeutic target in esophageal squamous cell carcinoma. PMID: 26667143
  35. Membrane-associated PGES1-dependent release of PGE2 is accompanied by elevated CCR7 expression in colon cancer cells. PMID: 26352871
  36. Pyk2 is a key downstream signaling molecule of CCR7 in SCCHN, promoting SCCHN tumorigenesis and progression. PMID: 26352169
  37. The CCR7 axis mediates TGF-beta1-induced EMT via crosstalk with NF-kappaB signaling, facilitating lymph node metastasis and poorer overall survival in patients with gastric cancer. PMID: 26176983
  38. Blockade of CCR7 or treatment with a p38 MAP kinase inhibitor reduced lymphatic dissemination of epithelial-mesenchymal transition cells. PMID: 25961925
  39. Findings indicated that circulating memory Tfh cells, particularly CCR7+ICOS+ memory Tfh cells, may be associated with multiple sclerosis relapse and could serve as a novel therapeutic target. PMID: 26231034
  40. The chemotactic interaction between CCR7 and its ligand, CCL21, might be a critical event during progression in pancreatic cancer. PMID: 21594558
  41. CrkL regulates CCL19 and CCR7-induced epithelial-to-mesenchymal transition via the ERK signaling pathway in epithelial ovarian carcinoma patients. PMID: 25636509
  42. Recycling accounts, to a significant extent, for the high levels of surface CXCR4/CCR7 on chronic lymphocytic leukemia (CLL) cells. Increased CCR4/CCR7 is detectable not only in circulating leukemic cells but also in secondary lymphoid organs of CLL patients with lymphoadenopathy. PMID: 26282174
  43. In given donor/recipient pairs, KIR2DS4 expression may contribute to potentiating natural killer cell function by increasing both cytotoxicity and CCR7 expression on their surface. PMID: 25961063
  44. Data indicate that inhibition of TGF-beta-activated protein kinase 1 (TAK1) reduces chemokine (C-C motif) receptor 7 (CCR7) expression. PMID: 25557171
  45. The CCL21/CCR7 pathway activates signaling to up-regulate the Slug pathway, leading to the occurrence of epithelial-mesenchymal transition in human chondrosarcoma. PMID: 25556164
  46. The study suggests that CCR7 promotes Snail expression to induce the epithelial-mesenchymal transition, resulting in cell cycle progression, migration, and invasion in gastric cancer. PMID: 25572817
  47. High CCR7 expression was associated with colorectal cancer metastasis. PMID: 26179425
  48. The solution structure of CCL19 has been reported, revealing a canonical chemokine domain. Chemical shift mapping shows that the N-termini of PSGL-1 and CCR7 have overlapping binding sites for CCL19, and binding is competitive. PMID: 26115234
  49. These results reveal that CCR7 and VEGF-C exhibit a significant crosstalk and suggest a novel role of the CCL21/CCR7 chemokine axis in promoting breast cancer-induced lymphangiogenesis. PMID: 25744065
  50. High expression of CCR-7 is associated with atherosclerotic arteries. PMID: 25318003

Show More

Hide All

Database Links

HGNC: 1608

OMIM: 600242

KEGG: hsa:1236

STRING: 9606.ENSP00000246657

UniGene: Hs.370036

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in various lymphoid tissues and activated B- and T-lymphocytes, strongly up-regulated in B-cells infected with Epstein-Barr virus and T-cells infected with herpesvirus 6 or 7.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.