Recombinant Human C-C motif chemokine 22 (CCL22)

Shipped with Ice Packs
In Stock

Description

Nomenclature and Identification

CCL22 is recognized by multiple aliases in scientific literature, reflecting its discovery path and functional characterization over time:

Official NameAlternative DesignationsMolecular Identifiers
C-C motif chemokine 22 (CCL22)Macrophage-derived chemokine (MDC)
CC chemokine STCP-1
Small inducible cytokine A22
Stimulated T cell chemotactic protein 1
MDC(1-69)
UniProt ID: O00626 (Human)
Entrez Gene ID: 6367 (Human)

The gene encoding CCL22 is also known by several aliases including A-152E5.1, ABCD-1, DC/B-CK, SCYA22, and STCP-1 . This diversity in nomenclature reflects the parallel discovery and characterization of this molecule by different research groups across various biological contexts.

Cellular Sources

CCL22 demonstrates a distinctive expression pattern primarily associated with cells of the immune system. It is highly expressed in macrophages and monocyte-derived dendritic cells, suggesting its important role in myeloid cell function . Additionally, CCL22 expression has been detected in activated monocytes as well as both resting and activated macrophages, indicating its involvement in both homeostatic and inflammatory conditions .

Anatomical Distribution

From an anatomical perspective, CCL22 shows enriched expression in lymphoid tissues. Significant presence has been documented in the thymus, lymph nodes, and appendix . This distribution pattern aligns with its functional role in immune cell trafficking and intercellular communication within secondary lymphoid organs, where adaptive immune responses are coordinated.

Chemotactic Activities

CCL22 exhibits selective chemotactic properties toward specific immune cell populations. It functions as:

  • A potent chemoattractant for chronically activated T-lymphocytes

  • A mild chemoattractant for primary activated T-lymphocytes

  • An effective chemotactic factor for monocytes, dendritic cells, and natural killer cells

  • Not chemotactic for neutrophils, eosinophils, or resting T-lymphocytes

This selective activity profile suggests specialized roles in directing specific immune cell subsets to sites of inflammation or immune activation.

Receptor Binding and Signaling

CCL22 primarily signals through binding to the CC chemokine receptor 4 (CCR4), a G-protein-coupled receptor (GPCR) expressed on various immune cells . The interaction between CCL22 and CCR4 triggers intracellular signaling cascades that regulate cell migration, activation, and effector functions.

Research has revealed that mutations in CCL22 can lead to altered receptor signaling dynamics. Specifically, certain mutations result in ligand-biased chemokine receptor signaling with decreased internalization of CCR4 due to impaired β-arrestin recruitment . This dysregulation can enhance cell chemotaxis and promote abnormal cellular proliferation, particularly in natural killer cells.

Immunomodulatory Effects

Beyond chemotaxis, CCL22 plays important roles in modulating immune cell function. Recent research has identified a significant mechanism by which CCL22 induces dendritic cell tolerance through the CCR4–Dectin2–PLC-γ2–NFATC2–Nr4a2–PD-L1 signaling pathway . Through this mechanism, CCL22 upregulates the expression of immune regulatory molecules including PD-L1, IL-6, and IL-10 in dendritic cells, potentially contributing to immune suppression in certain contexts .

Role in Radiation-Induced Injury

CCL22 has been implicated in the pathogenesis of radiation-induced lung injury (RILI). Studies have demonstrated that ionizing radiation increases CCL22 expression in alveolar type II epithelial (AT2) cells, leading to the attraction of CCR4-positive dendritic cells to the injury site . This recruitment mechanism represents a key step in the development of radiation-induced inflammatory damage in lung tissue.

The subsequent polarization of immature dendritic cells into a tolerant phenotype by CCL22 appears to regulate lung immunity following radiation exposure. This process involves the CCR4–Dectin2–PLC-γ2–NFATC2–Nr4a2–PD-L1 pathway and highlights potential therapeutic targets for addressing radiation-induced tissue damage .

Implications in NK Cell Lymphoproliferative Disease

Somatic mutations in the CCL22 gene have been identified as a significant factor in natural killer (NK) cell lymphoproliferative disorders. Transcriptome sequencing analysis of chronic lymphoproliferative disorders of natural killer cells (CLPD-NK) has revealed CCL22 mutations in approximately 21.5% of cases (27% in a discovery cohort and 16% in a validation cohort) .

CohortTotal CasesCCL22 Mutated CasesPercentage
Discovery591627%
Validation621016%
Combined1212621.5%

These mutations primarily occur at highly conserved residues (Leu45, Pro46, and Pro79) and define a distinct subgroup of CD56 bright CLPD-NK . Notably, CCL22 mutations appear to be mutually exclusive of STAT3 mutations but can coincide with TET2 mutations. The functional consequences of these mutations include:

  • Ligand-biased chemokine receptor signaling

  • Decreased internalization of CCR4 due to impaired β-arrestin recruitment

  • Increased cell chemotaxis in vitro

  • Enhanced bidirectional crosstalk with the hematopoietic microenvironment

  • Promotion of NK cell proliferation in vivo in transgenic human IL-15 mice

This represents a unique mechanism of tumor formation where gain-of-function chemokine mutations promote tumorigenesis through biased G-protein-coupled receptor signaling and dysregulation of microenvironmental interactions.

Current Research Applications

Recombinant Human CCL22 serves as a valuable tool in laboratory research focused on immune cell trafficking, inflammation, and cancer biology. Commercial preparations are available for research purposes, typically shipped at ambient temperature with specific storage, handling, and reconstitution information provided in lot-specific Certificates of Analysis .

These products are designated "For Research Use Only" and are not intended for diagnostic procedures or unauthorized resale . This status reflects their current utility as experimental reagents rather than clinical diagnostics or therapeutics.

Emerging Therapeutic Implications

The detailed characterization of CCL22's role in various pathological conditions suggests potential therapeutic applications. In radiation-induced lung injury, targeting the CCL22-CCR4 axis or downstream signaling components might help mitigate inflammatory damage . Similarly, in NK cell lymphoproliferative disorders, addressing aberrant CCL22 signaling could potentially disrupt pathological NK cell proliferation and disease progression .

The elucidation of CCL22's involvement in dendritic cell tolerance through the CCR4–Dectin2–PLC-γ2–NFATC2–Nr4a2–PD-L1 pathway also highlights potential immunomodulatory strategies that could be applied in autoimmune conditions or cancer immunotherapy contexts .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments include standard blue ice packs. If you require dry ice, please inform us in advance and additional fees will apply.
Notes
Avoid repeated freezing and thawing. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
ADAM11; MDC; Disintegrin and metalloproteinase domain-containing protein 11; ADAM 11; Metalloproteinase-like, disintegrin-like, and cysteine-rich protein; MDC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
226-769
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
ADAM11
Target Protein Sequence
QVRRGHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGRTFQSTSSGAAYVGGICSLSHGGGVNEYGNMGAMAVTLAQTLGQNLGMMWNKHRSSAGDCKCPDIWLGCIMEDTGFYLPRKFSRCSIDEYNQFLQEGGGSCLFNKPLKLLDPPECGNGFVEAGEECDCGSVQECSRAGGNCCKKCTLTHDAMCSDGLCCRRCKYEPRGVSCREAVNECDIAETCTGDSSQCPPNLHKLDGYYCDHEQGRCYGGRCKTRDRQCQVLWGHAAADRFCYEKLNVEGTERGSCGRKGSGWVQCSKQDVLCGFLLCVNISGAPRLGDLVGDISSVTFYHQGKELDCRGGHVQLADGSDLSYVEDGTACGPNMLCLDHRCLPASAFNFSTCPGSGERRICSHHGVCSNEGKCICQPDWTGKDCSIHNPLPTSPPTGETERYKGPSGTNIIIGSIAGAVLVAAIVLGGTGWGFKNIRRGRSGGA
Uniprot No.

Target Background

Function
Probable ligand for integrin in the brain. This is a non-catalytic metalloprotease-like protein.
Database Links

HGNC: 189

OMIM: 155120

KEGG: hsa:4185

STRING: 9606.ENSP00000200557

UniGene: Hs.6088

Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed predominantly in brain. Slightly detected or not at all in other tissues.

Q&A

What is the basic structure of recombinant human CCL22?

Recombinant human CCL22 is derived from a 93 amino acid precursor protein with a 24 amino acid signal peptide that gets cleaved to yield a mature protein spanning from Gly25 to Gln93 (69 amino acids) with a molecular weight of approximately 8 kDa . When produced recombinantly in E. coli expression systems, the protein maintains the characteristic CC chemokine fold while showing less than 35% amino acid sequence identity to other CC chemokine family members . Two isoforms have been identified in natural systems - the predicted mature form and a truncated variant with an amino-terminal sequence starting with YGANM (two amino acids shorter), typically secreted by CD8+ T lymphocytes .

How does recombinant CCL22 differ from native CCL22 in terms of structural properties?

Recombinantly produced CCL22, particularly from E. coli systems, lacks post-translational modifications that might be present in mammalian-expressed native CCL22. While the amino acid sequence remains identical to the native form (when properly designed), differences in glycosylation patterns may affect protein stability and receptor interaction kinetics. From a methodological perspective, researchers should consider these differences when designing experiments - E. coli-derived recombinant CCL22 is suitable for in vitro functional assays with an effective concentration range of 0.5-3 ng/mL for chemotactic responses . For studies where post-translational modifications are critical, mammalian expression systems may provide more physiologically relevant forms of the protein.

What are the critical structural elements of CCL22 that determine its receptor specificity?

The N-terminal region of CCL22 plays a crucial role in its receptor binding properties and specificity for CCR4. Structure-function analyses reveal that even minor N-terminal modifications, as seen in the natural YGANM isoform compared to the predicted mature form, can potentially alter receptor activation profiles . The CC motif (two adjacent cysteines) is essential for maintaining the tertiary structure through disulfide bonding that positions the N-terminal region correctly for receptor engagement. For experimental applications requiring specific CCR4 activation, it's important to verify the N-terminal integrity of recombinant CCL22 preparations, as proteolytic degradation during purification can significantly alter receptor binding properties.

How is CCL22 expression regulated at the transcriptional and post-transcriptional levels?

CCL22 expression involves complex regulatory mechanisms at both transcriptional and post-transcriptional levels. Transcriptionally, CCL22 is upregulated in dendritic cells, macrophages, and activated monocytes . Post-transcriptionally, research has identified a novel regulatory mechanism involving ribosomal protein L22 (RPL22) in LPS-activated differentiated THP-1 cells . Following LPS treatment, RPL22 is transcriptionally upregulated and accumulates in the nucleus, where it binds to the first 20 nucleotides of the 5'UTR of CCL2 mRNA . This interaction, coupled with the nuclear translocation of up-frameshift-1 protein, results in the cytoplasmic degradation of CCL2 mRNA at later stages of the inflammatory response . This mechanism represents a critical control point that fine-tunes CCL22 expression during inflammation to prevent excessive immune cell recruitment.

Which cell types predominantly express CCL22 under normal and inflammatory conditions?

Under normal physiological conditions, CCL22 is primarily expressed in dendritic cells, macrophages, and to some extent in thymic epithelial cells . Tissue-wise, expression is detected in thymus, lymph nodes, and appendix . Under inflammatory conditions, activated monocytes significantly upregulate CCL22 production. In pathological settings such as cancer, tumor-associated macrophages (TAMs) have been identified as major producers of CCL22, particularly those designated as "pri-TAMs" and "pol-TAMs" in esophageal squamous cell carcinoma . The spatial distribution of CCL22-producing cells is also context-dependent - in tumor microenvironments, CCL22-positive TAMs are predominantly located in regions surrounding tumor cells and co-express macrophage markers like CD204 . Experimental approaches to identify CCL22-expressing cells should include both flow cytometry and immunohistochemistry/immunofluorescence to capture both quantitative expression levels and spatial distribution.

What is the chromosomal location of the human CCL22 gene and how does this influence its co-regulation with other chemokines?

Unlike many other CC chemokines clustered on chromosome 17, the human CCL22 gene maps to chromosome 16 . This distinct chromosomal localization suggests separate evolutionary origin and regulatory control compared to other CC chemokine family members. This genomic separation likely explains why CCL22 shows less than 35% sequence identity with other CC chemokines and may have unique expression patterns during immune responses . From a research perspective, this genomic isolation means that CCL22 expression might not follow the same coordinated regulation observed in chemokine clusters, potentially requiring specific transcription factors or chromatin modifications for its expression.

How does CCL22 regulate T regulatory cell function and what experimental systems best demonstrate this activity?

CCL22 plays a critical role in T regulatory cell (Treg) function by mediating preferential interaction between dendritic cells (DCs) and Tregs. Research using CCL22-deficient (Ccl22−/−) mouse models has demonstrated that CCL22 deficiency results in a significant reduction of DC-Treg contacts and impairs Treg-mediated immune suppression . In experimental co-culture systems with DCs and a mixture of regulatory and conventional T cells, wild-type DCs show approximately three times more interactions with Tregs than conventional T cells, while CCL22-deficient DCs lose this preferential interaction .

Three-dimensional collagen gel matrix assays with live-cell imaging provide an optimal experimental system to visualize and quantify these interactions. In these assays, both DCs and T cells maintain motility within the gel matrix (≈2.6 μm/min velocity), with contacts between cells lasting approximately 22 minutes on average . This methodology allows for precise measurement of contact frequency and duration between DCs and different T cell subsets, clearly demonstrating CCL22's role in promoting Treg recruitment to DCs.

What is the relationship between CCL22 and its receptor CCR4 in modulating immune responses?

CCL22 exerts its immunomodulatory effects primarily through binding to CCR4, which is highly expressed on regulatory T cells. This CCL22-CCR4 axis is essential for balancing immune responses, as demonstrated in vaccination studies. When wild-type mice are immunized with CCL22-deficient dendritic cells pulsed with OVA peptide, they develop substantially stronger T cell immune responses compared to immunization with wild-type DCs . Importantly, this enhanced immune response is abrogated in CCR4-deficient (Ccr4−/−) mice, confirming that CCL22 regulates T cell immunity specifically through CCR4 .

CCR4 activation by CCL22 triggers calcium mobilization, a key signal transduction event that can be measured experimentally using calcium detection assays . For researchers investigating this signaling pathway, recombinant CCL22 at 50 ng/ml effectively induces measurable increases in intracellular calcium concentrations in CCR4-expressing cells . These calcium flux assays provide a straightforward method to confirm CCL22-CCR4 functional interaction in experimental systems.

What role does CCL22 play in tumor immunology and cancer progression?

CCL22 has emerged as a significant factor in tumor immunology, particularly through its production by tumor-associated macrophages (TAMs). In esophageal squamous cell carcinoma (ESCC), CCL22-positive TAMs are predominantly distributed in regions surrounding tumor cells and strongly correlate with lymph node metastasis . Kaplan-Meier survival analysis demonstrates that patients with high numbers of CCL22-positive TAMs have significantly worse survival outcomes compared to those with low numbers .

Mechanistically, CCL22 secreted by TAMs activates CCR4 receptors on various cells within the tumor microenvironment. This activation mediates the membrane recruitment of diacylglycerol kinase α (DGKα) through a series of biological processes that ultimately promote focal adhesion kinase (FAK) activation and cancer invasion . These findings suggest that CCL22 may serve as both a prognostic biomarker and potential therapeutic target in certain cancers.

For researchers investigating CCL22 in cancer contexts, multiplex tissue staining techniques are particularly valuable, as they allow simultaneous visualization of multiple markers (e.g., CD204 and CCL22) to identify specific cell populations within the complex tumor microenvironment .

What are the optimal conditions for using recombinant CCL22 in chemotaxis assays?

When conducting chemotaxis assays with recombinant CCL22, several methodological considerations are critical for reliable results. The effective concentration range for CCL22-induced chemotaxis is typically 0.5-3 ng/mL , though this may vary depending on the target cell type. For migration assays using Transwell systems (5 μm pore diameter), a concentration of 50 ng/mL recombinant CCL22 serves as an effective chemoattractant .

For optimal experimental design:

  • Freshly isolated splenocytes or purified T cell subsets should be placed in the upper chamber of the Transwell system (typically 1 × 10^6 cells).

  • Recombinant CCL22 or conditioned media from CCL22-producing cells should be placed in the lower chamber.

  • Migration should be assessed after 4-6 hours by harvesting and analyzing cells that have migrated to the lower chamber using flow cytometry .

  • Include appropriate controls, such as media alone (negative control) and other chemokines known to attract your cell population of interest (positive control).

  • For quantification, specific T cell subsets should be identified by appropriate markers (e.g., CD3, CD4, CD25, Foxp3 for Tregs) in flow cytometric analysis.

How can researchers effectively measure CCL22-CCR4 signaling in experimental systems?

Measurement of CCL22-CCR4 signaling can be accomplished through several complementary approaches:

  • Calcium Mobilization Assays: CCL22 binding to CCR4 triggers increases in intracellular calcium that can be measured using calcium-sensitive fluorescent dyes. This approach provides a rapid (seconds to minutes) assessment of receptor activation. Effective concentration of CCL22 for these assays is typically 50 ng/ml .

  • Protein Phosphorylation: CCR4 activation leads to phosphorylation of downstream signaling molecules. Western blotting for phosphorylated forms of signaling proteins (e.g., ERK, AKT) provides information on signaling pathway activation at longer time points (minutes to hours).

  • Receptor Internalization: Following activation, CCR4 undergoes internalization. This can be measured using flow cytometry to detect surface levels of CCR4 before and after CCL22 treatment.

  • Functional Readouts: For certain cell types, CCL22-CCR4 signaling results in specific functional outcomes that can be measured:

    • Chemotaxis assays for cell migration

    • Adhesion assays for increased cellular binding

    • Proliferation assays for growth responses

    • Cytokine production measurements

For all these approaches, appropriate controls should include CCR4 antagonists or cells lacking CCR4 expression to confirm signal specificity.

What considerations should be made when designing in vivo experiments to study CCL22 function?

When designing in vivo experiments to study CCL22 function, several important considerations should be addressed:

  • Genetic Models: Utilize Ccl22−/− knockout mice to study loss-of-function effects. These models have been created through homologous recombination using lacZ neomycin reporter vectors . For receptor studies, Ccr4−/− mice provide valuable insights into the specificity of CCL22 effects.

  • Cell Tracking: For studies on cellular migration, cells of interest should be fluorescently labeled before transfer. For example, dendritic cells can be stained with eFluor450 (5 μM) prior to subcutaneous injection to track their migration to draining lymph nodes .

  • Delivery Dosing: When administering recombinant CCL22, consider that physiological concentrations in tissues are typically in the picogram to nanogram range. Excessive doses may lead to receptor desensitization and non-physiological responses.

  • Timing Considerations: CCL22-mediated effects may be time-dependent. For DC migration studies, analysis at 36 hours post-injection has been shown to effectively capture the migratory behavior .

  • Conditional Expression Systems: For controlled expression studies, doxycycline-inducible CCL22 expression systems have been successfully employed in vivo .

  • Readout Parameters: Depending on the specific aspect of CCL22 function being studied, appropriate readout parameters might include:

    • Immune cell recruitment to specific tissues

    • T cell response magnitudes following vaccination

    • Tumor growth kinetics in cancer models

    • Measures of inflammatory response in disease models

These methodological considerations help ensure robust and physiologically relevant assessment of CCL22 function in vivo.

How can CCL22 expression levels be utilized as a prognostic biomarker in cancer?

The prognostic value of CCL22 likely stems from its role in creating an immunosuppressive microenvironment through Treg recruitment, as well as its direct effects on promoting tumor cell invasion through CCR4 activation.

What therapeutic approaches might target the CCL22-CCR4 axis in disease states?

The CCL22-CCR4 signaling axis represents a promising therapeutic target for various disease states, particularly those involving dysregulated immune responses. Several potential therapeutic approaches include:

  • CCR4 Antagonists: Small molecule inhibitors or neutralizing antibodies that block CCL22 binding to CCR4 could reduce Treg recruitment to tumors or sites of inappropriate immune suppression. These approaches have shown promise in preclinical cancer models.

  • CCL22 Neutralizing Antibodies: Direct neutralization of CCL22 using specific antibodies could prevent its immunomodulatory effects. This approach may be particularly relevant in cancer settings where high CCL22 levels correlate with poor prognosis.

  • Targeting CCL22 Production: Since post-transcriptional regulation by RPL22 has been shown to control CCL22 expression , developing molecules that enhance this natural regulatory mechanism could provide a novel approach to reducing CCL22 levels.

  • Cell-Based Therapies: Genetic modification of dendritic cells to alter their CCL22 production capabilities has shown promising results in vaccination studies . CCL22-deficient DCs induce substantially stronger T cell immune responses compared to wild-type DCs, suggesting potential applications in cancer immunotherapy.

  • Combined Approaches: Targeting the CCL22-CCR4 axis in combination with established immunotherapies (e.g., checkpoint inhibitors) might overcome resistance mechanisms and enhance therapeutic efficacy.

For researchers developing these therapeutic approaches, it's essential to consider the dual role of CCL22 in both protective immunity and pathological conditions, necessitating careful targeting to specific disease contexts.

What role does CCL22 play in viral immunity, particularly regarding HIV infection?

CCL22 has been identified as having significant antiviral properties, particularly against HIV-1 infection. Research has demonstrated that CCL22 derived from CD8+ T lymphocytes functions as a soluble suppressor of infection by both primary non-syncytium-inducing and syncytium-inducing HIV-1 isolates, as well as T-cell line-adapted HIV-1 IIIB . This suppressive activity appears to be mediated by a slightly truncated form of CCL22 with an amino-terminal sequence beginning with YGANM, which is two amino acids shorter than the predicted mature CCL22 protein .

From a mechanistic perspective, CCL22 may exert its anti-HIV effects through several possible pathways:

  • Competition for viral co-receptors

  • Induction of intracellular antiviral states in target cells

  • Modulation of target cell susceptibility to infection

  • Alterations in the inflammatory environment that influence viral replication

For researchers investigating CCL22's role in viral immunity, several experimental approaches could be valuable:

  • In vitro infection assays using primary CD4+ T cells in the presence of various concentrations of recombinant CCL22

  • Structure-function analyses comparing the antiviral potency of different CCL22 isoforms

  • Receptor blocking studies to determine whether CCL22's antiviral effects are dependent on CCR4 signaling

  • In vivo studies using CCL22-deficient mice to assess susceptibility to viral infections

These investigations could potentially lead to novel antiviral therapeutic strategies based on CCL22's natural suppressive properties against HIV and possibly other viruses.

What are the common challenges in producing high-quality recombinant CCL22 and how can they be addressed?

Production of high-quality recombinant CCL22 presents several technical challenges that researchers should consider when planning experiments:

  • Protein Folding Issues: As a chemokine with multiple disulfide bonds, CCL22 requires proper folding for biological activity. E. coli expression systems, while commonly used, may yield proteins with incorrect disulfide bond formation . Solution: Consider using specialized E. coli strains with enhanced disulfide bond formation capabilities or switch to eukaryotic expression systems for more complex applications.

  • N-terminal Heterogeneity: The biological activity of CCL22 is sensitive to N-terminal processing. Recombinant production may yield preparations with heterogeneous N-termini due to variable processing by bacterial proteases . Solution: Include purification steps that separate different N-terminal variants, such as reverse-phase HPLC, or design constructs with precise cleavage sites for specific proteases.

  • Endotoxin Contamination: E. coli-derived proteins often contain endotoxin contamination that can confound immunological experiments. Solution: Implement specific endotoxin removal steps during purification and confirm levels using Limulus Amebocyte Lysate (LAL) assays.

  • Protein Aggregation: Chemokines can self-associate at higher concentrations, potentially affecting their biological activity. Solution: Optimize buffer conditions to minimize aggregation and use techniques like dynamic light scattering to monitor the monomeric state of the protein.

  • Activity Verification: Confirming the biological activity of recombinant CCL22 preparations is essential. Solution: Implement functional assays such as chemotaxis of CCR4-expressing cells or calcium mobilization assays to verify activity .

How can researchers effectively study CCL22 in complex tissue microenvironments?

Studying CCL22 in complex tissue microenvironments, such as tumors or inflammatory tissues, requires specialized approaches:

  • Multiplex Imaging Techniques: Simultaneous visualization of CCL22 with other markers (e.g., cell type-specific markers) provides crucial contextual information. Multiplex immunofluorescence or immunohistochemistry can identify CCL22-producing cells within tissues . For example, co-staining for CCL22 and CD204 can specifically identify CCL22-producing macrophages in tumor samples.

  • Three-Dimensional Culture Systems: Collagen gel matrix assays with live-cell imaging provide valuable insights into cellular interactions mediated by CCL22 . This approach allows for:

    • Visualization of cell movements in three dimensions

    • Quantification of contact duration between different cell types

    • Assessment of chemotactic responses in a tissue-like environment

  • Single-Cell Analysis: Single-cell RNA sequencing can identify specific cell populations producing CCL22 within heterogeneous tissues and reveal co-expression patterns with other immunomodulatory factors.

  • Laser Capture Microdissection: This technique allows isolation of specific tissue regions for focused analysis of CCL22 expression and its correlation with particular microenvironmental features.

  • In Situ Proximity Ligation Assays: These assays can detect CCL22-CCR4 interactions directly within tissue sections, providing spatial information about where signaling is occurring.

These methodological approaches enable researchers to move beyond simple expression analysis to understand the functional significance of CCL22 in complex biological contexts.

What are the key considerations for developing CCL22 as a therapeutic target?

Developing CCL22 as a therapeutic target requires careful consideration of several factors:

  • Context-Dependent Effects: CCL22 plays dual roles in immunity - it can both promote regulatory T cell functions (potentially detrimental in cancer) and exhibit protective effects in certain contexts (such as HIV infection) . Therapeutic targeting must account for these context-dependent functions and focus on disease-specific mechanisms.

  • Target Validation: Robust validation of CCL22 as a therapeutic target requires:

    • Genetic evidence (e.g., phenotypes of Ccl22−/− mice in disease models)

    • Correlation with human disease (e.g., CCL22 levels in patient samples)

    • Proof-of-concept studies using neutralizing antibodies or receptor antagonists

  • Biomarker Development: Companion biomarkers to identify patients likely to respond to CCL22-targeted therapies are essential. These might include:

    • Tissue expression levels of CCL22 or CCR4

    • Regulatory T cell infiltration patterns

    • Genetic or transcriptomic signatures associated with CCL22 pathway activation

  • Delivery Considerations: For therapeutic modulation of CCL22, consider:

    • Local vs. systemic delivery (based on disease context)

    • Timing of intervention (acute vs. chronic treatment)

    • Combination with other immunomodulatory agents

  • Safety Assessment: Given CCL22's role in normal immune function, thorough safety evaluation must assess:

    • Effects on protective immunity against infections

    • Potential for autoimmune manifestations with CCL22 pathway inhibition

    • Long-term consequences of altering T regulatory cell function

By addressing these considerations, researchers can more effectively translate findings on CCL22 biology into therapeutic applications for diseases ranging from cancer to inflammatory conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.