Recombinant Human C-X-C chemokine receptor type 2 (CXCR2)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Properties

Recombinant Human CXCR2 is a laboratory-engineered form of the chemokine receptor CXCR2, produced in E. coli or other expression systems. Key characteristics include:

PropertyDetail
UniProt IDP25025
Molecular Weight20.6 kDa (partial protein, residues 1-40)
Expression SystemE. coli with N-terminal 6xHis-SUMO tag
LigandsIL-8, CXCL1, CXCL2, CXCL3, CXCL5, CXCL6, CXCL7, CXCL8
FunctionMediates neutrophil chemotaxis, angiogenesis, and tumor progression

CXCR2 is a G-protein-coupled receptor (GPCR) that signals through Gαi-dependent pathways, activating downstream effectors like PLC-β and PKC .

Angiogenesis

  • CXCR2 binds ELR+ CXC chemokines (e.g., IL-8, ENA-78) to drive endothelial cell chemotaxis and neovascularization .

  • Key Evidence:

    • Anti-CXCR2 antibodies inhibit angiogenesis by 97–99% in corneal micropocket assays .

    • CXCR2−/− mice show impaired vascularization in response to IL-8 and MIP-2 .

Immune Cell Recruitment

  • Mediates neutrophil migration to inflamed tissues and regulates macrophage infiltration in infections like Streptococcus pneumoniae .

  • Mechanism: Activates VASP via PKCδ/PKA to reorganize the actin cytoskeleton .

Cancer Progression

  • Tumor Growth: Promotes melanoma proliferation via CXCL1 binding .

  • Metastasis: Facilitates gastric cancer cell migration through CXCR2/STAT3 feedback loops with tumor-associated macrophages .

  • Therapeutic Target: CXCR2 inhibition reduces nonsmall cell lung carcinoma growth by 40–60% in preclinical models .

Signaling Pathways and Downstream Effects

PathwayKey ComponentsBiological Outcome
i ActivationPLC-β, DAG, IP3Calcium flux, PKCδ activation
Cytoskeletal RemodelingVASP, F-actinNeutrophil chemotaxis
Senescence/Fibrosisβ-catenin, p16^INK4A^, TGF-β1Tubular cell senescence, renal fibrosis

Key Studies

  1. Angiogenesis Inhibition (2000): Neutralizing CXCR2 antibodies block IL-8-induced endothelial chemotaxis, suggesting anti-angiogenic therapies for cancers .

  2. Renal Fibrosis (2022): CXCR2 overexpression in tubular cells triggers β-catenin-mediated mitochondrial dysfunction and senescence, reversible via SB225002 (CXCR2 inhibitor) .

  3. Gastric Cancer Metastasis (2019): Macrophage-derived CXCL1/5 activate CXCR2/STAT3 in GC cells, driving metastasis .

Therapeutic Strategies

  • CXCR2 Antagonists: SB225002 and reparixin show efficacy in reducing tumor growth and fibrosis .

  • Combination Therapies: Pairing CXCR2 inhibitors with immunotherapies enhances anti-tumor responses .

Challenges and Future Directions

  • Specificity Issues: CXCR2 ligands overlap with CXCR1, complicating targeted drug design .

  • Dual Roles in Immunity: While CXCR2 blockade reduces inflammation, it may impair infection clearance .

  • Emerging Applications: Role in cellular senescence opens avenues for treating age-related diseases .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please include them in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please communicate it to us. We will prioritize developing the specified tag if possible.
Synonyms
C-X-C chemokine receptor type 2; CD 182; CD182; CD182 antigen; CDw128b; Chemokine (CXC) receptor 2; CMKAR2; CXC-R2; CXCR 2; CXCR-2; CXCR2; CXCR2_HUMAN; GRO/MGSA receptor; High affinity interleukin-8 receptor B; IL 8 receptor type 2; IL 8R B; IL-8 receptor type 2; IL-8R B; IL8 RB; IL8 receptor type 2; IL8R B; IL8R2; IL8RA; Interleukin 8 Receptor B; Interleukin 8 receptor; beta; Interleukin 8 receptor; type 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
Uniprot No.

Target Background

Function
CXCR2 is the receptor for interleukin-8 (IL-8), a potent neutrophil chemotactic factor. Binding of IL-8 to CXCR2 activates neutrophils, triggering a G-protein-mediated response that activates a phosphatidylinositol-calcium second messenger system. CXCR2 binds IL-8 with high affinity. It also exhibits high-affinity binding to CXCL3, GRO/MGSA, and NAP-2.
Gene References Into Functions
  1. The CXCR2 rs1126579 TT genotype has been associated with a significantly increased likelihood of spontaneous HCV clearance. PMID: 29948377
  2. CXCR2 protein expression was upregulated in both the epileptic foci of temporal lobe epilepsy patients and in the pilocarpine mouse model. Administration of the CXCR2-selective antagonist SB225002 during the latency period preceding spontaneous recurrent seizures (SRSs) suppressed SRSs activity during the chronic epilepsy phase. PMID: 28705496
  3. Studies indicate that the CXCR2 +1208 CT genotype is less prevalent in advanced stages of prostate cancer, suggesting a potential role of this chemokine receptor in the pathogenesis of the disease. PMID: 28668699
  4. CXCR2 expression is a promoter of both local and distant colorectal cancer (CRC) metastasis and is associated with unfavorable prognosis for CRC patients. Furthermore, CXCR2 can stratify high-risk patients, particularly those in normally early-stage low-risk CRC. PMID: 28415702
  5. PADI4 contributes to gastric tumorigenesis by upregulating CXCR2, KRT14, and TNF-alpha expression. PMID: 27556695
  6. KHSV miR-K3 activates the GRK2/CXCR2/AKT axis, inducing KSHV-induced angiogenesis and promoting KSHV latency. PMID: 27058419
  7. CXCR2 mRNA and protein expression levels were significantly reduced in preeclamptic placentas compared to normal controls. Silencing CXCR2 significantly inhibited the invasive abilities of two trophoblast cell lines, while CXCR2 overexpression promoted trophoblast cell invasion. PMID: 27324095
  8. CXCR2 promotes breast cancer metastasis and chemoresistance by suppressing AKT1 and activating COX2. PMID: 28964785
  9. Research suggests that CXCR2 is essential for the recruitment of tumor-associated neutrophils (TANs), which can suppress antitumor T-cell responses. Elevated levels of CXCR2 ligands, particularly CXCL5, have been observed in both human and mouse pancreatic ductal adenocarcinoma (PDA). PMID: 27737879
  10. Studies have shown that neutrophil expression levels of CXCR2 are decreased in septic patients. PMID: 27016001
  11. CXCR4 and CXCR2 were highly expressed in a highly invasive gastric cancer cell model and in gastric cancer tissues. Crosstalk between CXCR4 and CXCR2 contributed to epithelial-mesenchymal transition (EMT), migration, and invasion of gastric cancer. PMID: 28481874
  12. A unique viral protein, vCXCL1, targets three chemokine receptors: CXCR1 and CXCR2 expressed on neutrophils and CXCR1 and CX3CR1 expressed on natural killer cells. PMID: 27160907
  13. CXCL1 expression in cancer cells and CXCR2 expression in stromal cells are valuable prognostic factors for gastric cancer patients. PMID: 28575019
  14. CXCR2 preferentially supports the maintenance of human pluripotent stem cell characteristics and facilitates ectodermal differentiation after commitment to differentiation. The underlying mechanism may be associated with mTOR, beta-catenin, and hTERT activities. PMID: 27188501
  15. Research has shown that CXCR2 expression was correlated with high grade (P = 0.024), advanced stage (P = 0.029), and metastasis (P = 0.018). The log-rank test revealed that high CXCR2 and CXCR3 expressions are associated with poorer overall survival (P < 0.001; P < 0.001). PMID: 27273823
  16. Evidence indicates that the CXCR2 network and CXCL4 play a role in maintaining normal hematopoietic stem cell/hematopoietic progenitor cell (HSC/HPC) cell fates, including survival and self-renewal. PMID: 27222476
  17. CXCR1 and CXCR2 regulate hepatocyte exosome release. While the mechanism utilized by CXCR1 remains unclear, CXCR2 appears to modulate neutral sphingomyelinase (Nsm) activity and resultant ceramide production to control exosome release. CXCR1 is required for packaging enzymes into exosomes that mediate their hepatocyte proliferative effect. PMID: 27551720
  18. TNF-alpha augments CXCR2 and CXCR3, promoting the progression of renal cell carcinoma, which leads to a poor prognosis. PMID: 27297979
  19. Data indicate the crystal structure of PDZ-RhoGEF PDZ domain in complex with the CXC chemokine receptor 2 (CXCR2) C-terminal PDZ binding motif. PMID: 28179147
  20. Treatment with 1,25D3 increased poly(I:C)-induced IL-8 mRNA and protein expression after 2 to 6 hours. However, when cells were pretreated with 1,25D3 for 24 hours, 1,25D3 decreased cytokine expression. PMID: 27196318
  21. Research identified novel pathways associated with glycophosphatidylinositol-anchored protein (GPI-AP)- granulocytes through RNA-seq and validated higher CXCR2 expression in GPI-AP- than GPI-AP+ granulocytes. PMID: 28151558
  22. Results identify the CXCL2/MIF-CXCR2 axis as a significant mediator in myeloid-derived suppressor cell (MDSC) recruitment and as predictors in bladder cancer. PMID: 27721403
  23. Studies demonstrate that CXCR2 signaling in the myeloid compartment promotes tumor growth and is required for pancreatic cancer metastasis. PMID: 27265504
  24. The potential of CXCR-2 as a tumor marker for esophageal cancer was investigated. PMID: 27906878
  25. Research shows that downregulation of CD182 after stimulation with IL-8 is more pronounced in adults compared to neonates, whereas formyl-methionyl-leucyl-phenylalanine (fMLP) induces changes in receptor expression that are of similar magnitude in neutrophils from neonates and adults. PMID: 27606963
  26. Findings indicate that miR-940 acts as a pivotal adapter of CXCR2, and its transcription downregulated CXCR2 expression, reducing hepatocellular carcinoma (HCC) invasion and migration in vitro. PMID: 27807540
  27. Research suggests that CXCL3 and its receptor CXCR2 are overexpressed in prostate cancer cells, prostate epithelial cells, and prostate cancer tissues, potentially playing multiple roles in prostate cancer progression and metastasis. PMID: 26837773
  28. Data suggest that neutrophil-activating peptide 2 (NAP-2) secreted by natural killer (NK) cells can bind to CXC Chemokine Receptor 2 (CXCR2) on mesenchymal stem cells (MSCs), leading to stimulation of their recruitment. PMID: 27052313
  29. High CXCR2 expression has been associated with pancreatic cancer. PMID: 26771140
  30. Results show that the CXCR2 rs1126579 polymorphism is significantly associated with ischemic stroke, both individually and in combination with the genotype and/or alleles of other chemokine genes. PMID: 26648969
  31. These studies provide direct evidence linking the activation of IL8, DNA demethylation, and the induction of the osteoarthritis (OA) process, suggesting potential therapeutic implications for OA patients. PMID: 26521741
  32. CXCR2 expression is enriched in human atherosclerotic coronary artery. PMID: 26287498
  33. The CXCR2-CXCL1 axis is correlated with neutrophil infiltration and predicts a poor prognosis in hepatocellular carcinoma. PMID: 26503598
  34. Research found that the mRNA level of NF-kappaB and IL-8 was higher in gastric ulcer patients, particularly in those with Helicobacter pylori-positive gastric ulcer. PMID: 26060478
  35. Studies show that CXCL5 expression is elevated in positive correlation to bladder cancer grade and promotes cell migration and invasion by binding to its receptor CXCR2. PMID: 26058729
  36. CXCR2 positivity combined with postoperative complications is associated with subsequent tumor recurrence in esophageal cancer. PMID: 26231560
  37. IL-10 rs1800896, CXCR2 rs1126579, and selected clinical features can be used as markers for septic shock development, but not for decreased survival. PMID: 26038959
  38. Investigations using methylation arrays observed that the promoters of immunomodulatory factors, COX2 and PTGES, and migration-related factors, CXCR2 and CXCR4, were hypomethylated after 5-aza treatment. PMID: 25620445
  39. TLR3 stimulates the differentiation of mesenchymal stromal cells from human tonsils into follicular dendritic cell-like cells and induces chemokine secretion, potentially by recruiting C-X-C chemokine receptor 2-expressing immune cells. PMID: 25794662
  40. Data show that long non-coding RNA MALAT1 silencing downregulated the expression of the microRNA miR-22-3p target gene CXCR2 and the AKT pathway. PMID: 26364720
  41. Research revealed a critical role of a PDZ-based CXCR2 macromolecular complex in endothelial progenitor cell (EPC) homing and angiogenesis. PMID: 25622052
  42. Results demonstrated that resistance to the anti-proliferative effects of CXCR2 may also arise from feedback increases in macrophage inflammatory protein-2 (MIP-2) secretion. PMID: 25682075
  43. CXCR2 is a potential independent adverse prognostic biomarker for recurrence and survival of patients with non-metastatic clear cell renal cell carcinoma (ccRCC) after nephrectomy. PMID: 26188847
  44. Results showed that Helicobacter pylori induced the activation of Jak1/Stat3 and IL-8 production, which was inhibited by a Jak/Stat3 specific inhibitor AG490 in AGS cells in a dose-dependent manner. PMID: 25837197
  45. Data indicate that the antibodies bound specifically to CXC chemokine receptor-2 (CXCR2) expressing cells. PMID: 25484047
  46. Data indicate the antibodies recognized distinct epitopes of CXC chemokine receptor-2 (CXCR2). PMID: 25484064
  47. Research revealed that circulating concentrations of IL-8 and IL-12 increase along with significant vascular threatening traits such as fasting serum glucose and very low-density lipoprotein cholesterol (VLDL-c), respectively. PMID: 25456886
  48. miR141-CXCL1-CXCR2 signaling-induced regulatory T cell (Treg) recruitment regulates metastases and survival of non-small cell lung cancer. PMID: 25349304
  49. A 3'UTR SNP modulates CXCR2 expression, signaling, and susceptibility to lung cancer. PMID: 25480945
  50. Data demonstrate that CXCR2 regulates bone marrow blood vessel repair/regeneration and hematopoietic recovery, and clinically may be a therapeutic target for improving bone marrow transplantation. PMID: 25757087

Show More

Hide All

Database Links

HGNC: 6027

OMIM: 146928

KEGG: hsa:3579

STRING: 9606.ENSP00000319635

UniGene: Hs.846

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Human CXCR2?

Recombinant Human CXCR2 is a G-protein coupled receptor consisting of 360 amino acids with seven transmembrane domains characteristic of this receptor family . The receptor contains extracellular N-terminal domains involved in ligand binding and intracellular C-terminal regions that interact with signaling molecules. CXCR2 shares structural homology with CXCR1, another chemokine receptor, with both containing conserved motifs critical for chemokine recognition and signal transduction . The receptor undergoes post-translational modifications, including phosphorylation upon ligand binding, which regulates receptor internalization and signaling cascades .

What are the primary ligands for CXCR2 and their binding properties?

CXCR2 binds with high affinity to several ELR+ (glutamic acid-leucine-arginine) CXC chemokines. Most prominently, it serves as a receptor for interleukin-8 (IL-8/CXCL8), which functions as a powerful neutrophil chemotactic factor . Additionally, CXCR2 binds with high affinity to CXCL3, growth-related oncogene/melanoma growth-stimulatory activity (GRO/MGSA), and neutrophil-activating peptide-2 (NAP-2) . These ELR-chemokines share similar structures, exist as monomers and dimers, and interact with tissue glycosaminoglycans (GAGs) . The receptor-ligand interactions are context-dependent, shaped by the local environment, and each chemokine can regulate CXCR2 activation in unique ways .

How does CXCR2 signaling operate at the cellular level?

CXCR2 signaling is initiated when ligands such as IL-8 bind to the receptor, causing activation of heterotrimeric G-proteins. This binding triggers the activation of a phosphatidylinositol-calcium second messenger system . Upon activation, CXCR2 mediates several downstream signaling pathways, including mitogen-activated protein kinase (MAPK) and nuclear factor kappa B (NF-κB) pathways . In neutrophils, CXCR2 activation results in chemotaxis toward inflammatory stimuli, while in cancer cells, CXCR2 signaling promotes multiple hallmarks of cancer, including cell cycle progression, inhibition of apoptosis, and stimulation of angiogenesis . The receptor undergoes phosphorylation upon ligand binding, which can lead to receptor internalization and signal termination .

How does CXCR2 contribute to cancer development and progression?

CXCR2 promotes cancer development and progression through multiple mechanisms affecting key hallmarks of cancer:

  • Cell cycle regulation: CXCR2 promotes cell cycle progression by modulating cell cycle regulatory proteins, including p21 (waf1/cip1), cyclin D1, CDK6, CDK4, cyclin A, and cyclin B1 .

  • Apoptosis inhibition: CXCR2 inhibits cellular apoptosis by suppressing phosphorylated p53, Puma, and Bcl-xS; suppressing poly(ADP-ribose) polymerase cleavage; and activating anti-apoptotic proteins Bcl-xL and Bcl-2 .

  • Angiogenesis stimulation: CXCR2 enhances angiogenesis by increasing levels of vascular endothelial growth factor (VEGF) and decreasing levels of thrombospondin-1 (TSP-1), a process likely involving MAPK and NF-κB signaling pathways .

  • Immune cell recruitment: CXCR2 mediates recruitment of neutrophils to the tumor microenvironment, where they can contribute to tumor growth, angiogenesis, and immunosuppression .

In experimental models, knockdown of CXCR2 expression by small hairpin RNA reduced tumorigenesis of ovarian cancer cells in nude mice, providing direct evidence for its role in cancer progression .

What strategies exist for targeting CXCR2 in cancer therapy?

Several therapeutic approaches targeting CXCR2 in cancer have been investigated:

  • Small molecule antagonists: Multiple CXCR2 antagonists have been evaluated in preclinical and clinical studies to block CXCR2 signaling and its downstream effects on tumor growth and metastasis .

  • Genetic engineering approaches: Silencing CXCR2 expression using RNA interference technologies (shRNA) has shown efficacy in reducing tumor growth in preclinical models .

  • Antibody development: High-affinity antibodies targeting CXCR2 have been developed that can compete with natural ligands and block receptor activation . These have potential for therapeutic development similar to anti-TNF antibodies but with the advantage of targeting the receptor rather than the ligand .

  • Combination therapies: CXCR2 inhibition combined with conventional therapies or immune checkpoint inhibitors has shown promise in enhancing treatment efficacy in preclinical cancer models .

The therapeutic potential of targeting CXCR2 extends to multiple cancer types, particularly those with demonstrated roles for CXCR2 in tumor progression, such as ovarian cancer, where CXCR2 inhibition affects multiple cancer hallmarks simultaneously .

How does CXCR2 regulate neutrophil function in inflammation?

CXCR2 is expressed at high levels in neutrophils and plays a critical role in regulating neutrophil migration and function during inflammation . Upon binding of chemokines like IL-8, CXCR2 activation triggers neutrophil chemotaxis toward inflammatory sites through G-protein-coupled signaling mechanisms that activate the phosphatidylinositol-calcium second messenger system . Studies using Cxcr2 tissue-specific knockouts have demonstrated that loss of CXCR2 in neutrophils resulted in reduced homing of neutrophils to inflammatory sites, improved insulin response, and less weight gain in metabolic disease models .

While CXCR2-mediated neutrophil recruitment is essential for normal inflammatory responses, dysregulated CXCR2 signaling can contribute to pathological inflammation in various diseases, including inflammatory bowel disease, glomerulonephritis, allergic asthma, chronic obstructive pulmonary disease, and cancer . This makes CXCR2 an attractive therapeutic target for conditions characterized by inappropriate neutrophil migration and activation.

What role does CXCR2 play in adoptive cell therapy approaches?

CXCR2 has emerged as a promising target for enhancing adoptive cell therapy (ACT) effectiveness by improving immune cell trafficking to tumors. Research has demonstrated that:

  • Enhanced T cell migration: Genetic modification of tumor-specific T cells to express CXCR2 significantly improves their ability to migrate toward tumor-derived chemokine gradients . This addresses one of the most important rate-limiting steps in ACT - the inefficient migration of T cells to tumors.

  • Improved tumor regression: Mice bearing tumors treated with CXCR2-transduced tumor-specific T cells showed enhanced tumor regression and survival compared to those receiving control T cells . Bioluminescence imaging confirmed preferential accumulation of CXCR2-expressing T cells at tumor sites.

  • NK cell functionality: Similarly, genetic engineering of human primary NK cells to express CXCR2 improved their ability to specifically migrate along chemokine gradients of recombinant CXCR2 ligands or tumor supernatants . This enhanced trafficking resulted in increased killing of target cells, while the NK cells' intrinsic functionality remained unchanged .

  • Increased adhesion properties: CXCR2-transduced NK cells demonstrated increased adhesion properties and formed more conjugates with target cells, further enhancing their anti-tumor activity .

These findings suggest that CXCR2 genetic engineering represents a promising strategy to improve the efficacy of both T cell and NK cell-based adoptive immunotherapies by enhancing immune cell migration to tumors expressing CXCR2 ligands.

What methods are effective for modulating CXCR2 expression in experimental settings?

Several techniques have been validated for modulating CXCR2 expression in research settings:

  • RNA interference: Stable small hairpin RNA (shRNA) has been effectively used to silence CXCR2 expression in cancer cell lines, such as T29Gro-1, T29H, and SKOV3 ovarian cancer cells . This approach allows for long-term suppression of CXCR2 expression for both in vitro and in vivo studies.

  • Viral transduction: Retroviral or lentiviral vectors carrying the CXCR2 gene have been successfully used to introduce and overexpress CXCR2 in various cell types, including primary T cells and NK cells . This genetic modification approach enables stable expression of CXCR2 in cells that normally lose expression during in vitro culture.

  • Tissue-specific knockout models: Conditional Cxcr2 knockout mice with tissue-specific deletion have been created to study CXCR2 function in specific cell types, particularly neutrophils . These models have been instrumental in revealing novel physiological roles of CXCR2 beyond its known functions in neutrophil chemotaxis.

  • Recombinant protein expression systems: For biochemical and structural studies, recombinant human CXCR2 protein has been expressed in systems such as wheat germ, providing full-length protein (1-360 amino acids) suitable for various applications including SDS-PAGE, ELISA, and Western blotting .

What assays can be used to evaluate CXCR2 function in different experimental systems?

A variety of assays have been developed to assess CXCR2 functionality:

  • Chemotaxis/Migration assays: Transwell migration assays are commonly used to evaluate CXCR2-dependent cell migration in response to chemokine gradients . These assays can assess migration along gradients of recombinant CXCR2 ligands or tumor supernatants.

  • Bioluminescence imaging: In vivo tracking of CXCR2-expressing cells can be achieved by co-transducing cells with luciferase genes, allowing real-time visualization of cell migration and accumulation in animal models .

  • Cell-cell adhesion assays: Conjugate formation assays measure the ability of CXCR2-expressing immune cells to form stable contacts with target cells, providing insights into the functional consequences of CXCR2 expression .

  • Cytotoxicity assays: For immune cells like NK cells or T cells, standard cytotoxicity assays can determine if CXCR2 expression enhances killing of target cells .

  • Signaling pathway analysis: Western blotting, electrophoretic mobility shift assays (EMSA), and phospho-specific flow cytometry can assess activation of downstream signaling pathways following CXCR2 stimulation, including MAPK and NF-κB pathways .

  • Angiogenesis assays: For studies investigating CXCR2's role in angiogenesis, assays measuring VEGF production, endothelial tube formation, and in vivo vascularization can be employed .

  • Cell cycle and apoptosis analysis: Flow cytometry-based assays for cell cycle distribution and apoptosis markers can evaluate CXCR2's effects on these fundamental cellular processes .

How can CXCR2 be exploited to enhance immune cell trafficking in immunotherapy?

Advanced strategies to exploit CXCR2 for enhancing immune cell trafficking include:

  • Personalized immunotherapy approaches: Given that different tumors express varying levels of CXCR2 ligands (CXCL1, CXCL8), analysis of chemokine expression patterns in individual patients' tumors could guide the selection of appropriate chemokine receptor engineering for adoptive cell therapies . This approach enables personalization of cancer therapies based on tumor chemokine expression profiles.

  • Dual receptor engineering: Combining CXCR2 with other chemokine receptors that respond to different chemokine families could potentially enhance immune cell trafficking to tumors with heterogeneous chemokine secretion patterns, addressing the challenge of tumor heterogeneity.

  • Switchable receptor systems: Development of synthetic biology approaches that allow for controlled activation of CXCR2 signaling in therapeutic immune cells, potentially using small molecule inducers or light-activated systems, could provide precise temporal control over immune cell trafficking.

  • Enhancing retention through adhesion molecule co-expression: Since CXCR2 has been shown to improve adhesion properties of immune cells , co-expression with additional adhesion molecules could further enhance immune cell retention at tumor sites after initial trafficking.

  • Combination with checkpoint inhibition: Combining CXCR2-mediated enhanced trafficking with checkpoint inhibitor therapy could potentially overcome resistance mechanisms by ensuring sufficient numbers of tumor-reactive immune cells reach the tumor microenvironment.

These advanced approaches aim to overcome the limitations of current immunotherapies by addressing the critical barrier of insufficient immune cell infiltration into tumors.

What are the emerging roles of CXCR2 beyond neutrophil chemotaxis and cancer?

Recent research has revealed numerous novel physiological roles for CXCR2 beyond its classical functions:

  • Central nervous system function: Studies using tissue-specific knockouts have identified roles for CXCR2 in neurological processes, including potential implications for neurodegenerative disorders and neuroinflammation .

  • Metabolic regulation: Loss of CXCR2 in neutrophils resulted in improved insulin response and reduced weight gain, suggesting roles in metabolic homeostasis and potential implications for metabolic disorders .

  • Reproductive biology: CXCR2 has been implicated in reproductive functions, though the specific mechanisms require further elucidation .

  • COVID-19 pathogenesis: CXCR2 plays a role in the inflammatory response associated with COVID-19, potentially contributing to the cytokine storm and severe symptoms observed in some patients .

  • Circadian rhythm regulation: Emerging evidence suggests CXCR2 involvement in response to circadian cycles, pointing to potential chronobiological functions .

  • Hematopoietic stem cell regulation: CXCR2 has been identified as important in the regulation of hematopoietic stem cells, with implications for both normal hematopoiesis and hematological malignancies .

These diverse functions highlight the complexity of CXCR2 biology and suggest potential new therapeutic applications beyond cancer and inflammatory diseases.

What challenges exist in developing CXCR2-targeted therapies for clinical applications?

Despite promising preclinical results, several challenges must be addressed for successful clinical translation of CXCR2-targeted therapies:

  • Balancing immune modulation: CXCR2 plays critical roles in normal immune function, particularly neutrophil-mediated responses to infection. Complete blockade of CXCR2 could potentially compromise host defense against pathogens, necessitating careful dosing and potentially intermittent treatment schedules.

  • Context-dependent functions: CXCR2 function is highly context-dependent, with its ligands exhibiting varying properties depending on the local environment . This complexity makes it difficult to predict therapeutic outcomes across different disease states and patient populations.

  • Redundancy in chemokine signaling: The chemokine system exhibits considerable redundancy, with multiple receptors capable of binding the same ligands and vice versa. This redundancy may limit the efficacy of targeting a single receptor like CXCR2.

  • Delivery challenges for cellular therapies: For adoptive cell therapy approaches using CXCR2-engineered cells, challenges include standardizing manufacturing processes, ensuring stable transgene expression, and developing cost-effective production methods suitable for clinical application .

  • Patient stratification: Given the variable expression of CXCR2 and its ligands across different tumors and patients, effective biomarkers will be needed to identify patients most likely to benefit from CXCR2-targeted therapies.

  • Optimizing combination approaches: Determining the optimal combination and sequencing of CXCR2-targeted therapies with conventional treatments (chemotherapy, radiation) or other immunotherapies remains a significant challenge requiring systematic clinical investigation.

Addressing these challenges through rigorous preclinical and clinical studies will be essential for realizing the full therapeutic potential of CXCR2-targeted approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.