Recombinant Human C-X-C chemokine receptor type 6 (CXCR6)

Shipped with Ice Packs
In Stock

Description

Research Applications and Experimental Uses

Recombinant CXCR6 is utilized in diverse experimental systems to study immune function and disease mechanisms.

Key Applications

  1. Immune Cell Trafficking

    • T Cell Homing: Co-transduction of CXCR6 with tumor-specific T cell receptors (TCRs) or chimeric antigen receptors (CARs) enhances T cell migration to CXCL16-expressing tumors, improving adoptive cell therapy (ACT) efficacy in pancreatic cancer models .

    • NK Cell Memory: CXCR6 is essential for the persistence of antigen-specific NK cell memory. Neutralizing CXCR6 abolishes delayed-type hypersensitivity (DTH) responses in Rag1−/− mice .

  2. Virus Entry Studies

    • HIV/SIV Coreceptor: Recombinant CXCR6 is used to study its role as a coreceptor for HIV-2 and M-tropic HIV-1 strains. This enables screening of antiviral compounds targeting viral entry .

  3. Cell Adhesion and Signaling Assays

    • Calcium Flux: Recombinant CXCR6-expressing cells show CXCL16-induced calcium mobilization, critical for identifying signaling pathway modulators .

    • Virus-Like Particles (VLPs): CXCR6-VLPs are used to display conformationally intact receptors for antibody screening and immunization studies .

Table 2: Experimental Models Using Recombinant CXCR6

ModelApplicationKey OutcomeSource
T Cell TherapyCo-transduction with CAREnhanced tumor infiltration and lysis
NK Cell MemoryAnti-CXCR6 antibody treatmentAbolished DTH responses
Viral EntryHIV entry assaysCoreceptor validation

Therapeutic Potential and Clinical Relevance

CXCR6’s dual role in immune regulation and pathogen entry positions it as a therapeutic target.

Cancer Immunotherapy

  • ACT Enhancement: CXCR6-engineered T cells demonstrate superior homing to CXCL16-rich tumors (e.g., pancreatic cancer), enabling targeted lysis .

  • Tumor Microenvironment Modulation: High CXCL16 expression in human pancreatic tumors validates CXCR6 as a viable therapeutic target .

Infectious Diseases

  • HIV Therapy: Blocking CXCR6 could inhibit viral entry, though this may conflict with its role in immune cell retention .

Autoimmune Diseases

  • Rheumatoid Arthritis: CXCR6+ memory T cells are recruited to CXCL16+ macrophages in synovial fluid, suggesting CXCR6 inhibition may reduce inflammation .

Challenges and Future Directions

  1. Production and Stability

    • Recombinant CXCR6 requires specialized expression systems (e.g., mammalian cells) to maintain proper folding .

    • Lyophilized formats (e.g., VLPs) improve storage stability but may require optimization for in vivo use .

  2. Off-Target Effects

    • CXCR6’s role in NK cell memory necessitates caution in therapeutic interventions to avoid immune dysfunction .

  3. Future Research

    • Bispecific Antibodies: Targeting CXCR6 and tumor antigens to enhance T cell recruitment.

    • CRISPR Editing: Modulating CXCR6 expression in immune cells for precision immunotherapy .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
CXCR6; BONZO; STRL33; TYMSTR; C-X-C chemokine receptor type 6; CXC-R6; CXCR-6; CDw186; G-protein coupled receptor STRL33; G-protein coupled receptor bonzo; CD antigen CD186
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYH KLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLIL TCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLIC GYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVF LLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFW KLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL
Uniprot No.

Target Background

Function
CXCR6 is a receptor for the C-X-C chemokine CXCL16. It functions as a coreceptor for SIVs and certain strains of HIV-2 and m-tropic HIV-1.
Gene References Into Functions
  1. Research indicates that macrophages can promote the migration and invasion of ovarian carcinoma cells by influencing the CXCL16/CXCR6 pathway. PMID: 30049511
  2. A study identified a population of gut-derived TREG cells producing CCR6 and CXCR6, which are significantly reduced in inflammatory bowel disease. PMID: 29981781
  3. CXCR6 expression in tumor tissue may serve as a potential prognostic biomarker for clear cell renal cell carcinoma (ccRCC) patients, enhancing clinical prognosis prediction alongside traditional clinical and pathological assessments following surgery. PMID: 28918166
  4. Data suggests that reverse signaling through CXCL16 promotes migration in CXCL16-expressing melanoma and glioblastoma cells but does not affect proliferation or protection from chemically-induced apoptosis. PMID: 28698473
  5. Findings demonstrate that CXCR6 is an independent prognostic factor for poor survival in gastric cancer patients, and it may promote gastric cancer metastasis through epithelial-mesenchymal transition. PMID: 28440473
  6. A comparative study investigated CXCR6 gene variation in two South African populations (black and Caucasian) and examined the possible association between two CXCR6 SNPs and different phenotypes of HIV-1 control in HIV-1-infected black South African individuals. PMID: 28428094
  7. The study demonstrated that CXCL16-CXCR6 mediates CD8(+) T-cell skin trafficking under oxidative stress in patients with vitiligo. PMID: 27826097
  8. The DRF motif of CXCR6 might exhibit a receptor adaptation, allowing adhesion and cell retention by transmembrane CXCL16 while reducing the chemotactic response to soluble CXCL16. PMID: 28267793
  9. Research reveals higher CXCR6 mRNA levels in osteosarcoma tissues compared to normal bone tissues. PMID: 27823764
  10. The CXCR6 rs2234358 polymorphism was associated with HCV spontaneous clearance and response to IFN-alpha/RBV therapy in the Chinese Han population. PMID: 28456591
  11. Elevated CXCR6 expression levels have been observed in gastric cancer. PMID: 25921630
  12. This study reports the expression of CXCL16 and its receptor, CXCR6, their immunolocalization in disc tissue, and their presence following exposure of cultured human annulus fibrosus cells to proinflammatory cytokines. PMID: 27869573
  13. Inflammation contributes to foam cell formation in the radial arteries of ESRD patients through activation of the CXCL16/CXCR6 pathway, which may be regulated by P2X7R. PMID: 27877078
  14. High CXCR6 expression is associated with prostate cancer. PMID: 26799186
  15. MiR-361-5p, down-regulated in Hepatocellular Carcinoma tissues compared to adjacent normal tissues due to hypermethylation at its promoter region, has been found to suppress HCC cell proliferation and invasion. Chemokine (C-X-C Motif) receptor 6 (CXCR6) is identified as a target of miR-361-5p. PMID: 26872014
  16. Wnt5a-Ror2 signaling enhances expression and secretion of CXCL16 in mesenchymal stem cells, subsequently activating CXCR6 expressed on tumor cells, promoting proliferation. PMID: 26708384
  17. High protein expression of CXCL16 and high protein co-expression of CXCL16/CXCR6 in prostate cancer were independent predictors of worse clinical outcomes. PMID: 26272362
  18. Evidence indicates that chemokine receptor CXCR6 and its sole natural ligand, CXCL16, are significantly expressed by non-small cell lung cancer (NSCLC) and are involved in the pathobiology of lung cancer. PMID: 25888629
  19. A study examined the expression of CXCL16 and CXCR6 and their relations to prognosis in 335 unselected patients with NSCLC, investigating potential relationships with previously studied immunologic and angiogenic markers. PMID: 26021984
  20. High expression of CXCR6 is positively associated with distant invasion in human hepatocellular carcinoma (HCC) patients. PMID: 25572735
  21. CXCL16/CXCR6 interaction might play a significant role in modifying the response of pDCs to environmental danger signals. PMID: 24302814
  22. Research suggests that the CXCL16/CXCR6 axis appears important in the progression of Ewing sarcoma family tumors. PMID: 24507753
  23. Data suggests that CXCR6 expression in T-cells and natural killer cells is up-regulated in subjects with metabolic syndrome and correlates with the severity of carotid atherosclerosis (e.g., intima-media thickness and plaque index). PMID: 23398954
  24. CXCL16 is highly expressed by glial tumor and stroma cells, while CXCR6 defines a subset of cells exhibiting stem cell characteristics. PMID: 23628207
  25. CXCR6 was found to be abundantly expressed in human meningioma samples across different malignant grades. PMID: 23229614
  26. This review proposes and discusses the potential to modulate tumor self-renewal affecting asymmetric/symmetric cell division by targeting specific factors like CXCR6. PMID: 22678828
  27. CXCL12/CXCR4 and CXCL16/CXCR6 expressions were significantly higher in epithelial ovarian carcinomas compared to normal epithelial ovarian tissues or benign epithelial ovarian tumors. CXCR6 expression was linked to lymph node metastasis. PMID: 21527066
  28. CXCL16 and CXCR6 might play a role in the pathophysiology of endometriosis through regulation of the inflammatory response. PMID: 21773780
  29. Findings indicate that CCR5, CXCR3, and CXCR6 contribute to the selective recruitment of T cells into renal cell carcinoma tissue, and, along with CCR6, to the recruitment of regulatory T cells. PMID: 22079021
  30. Results suggest that CXCL16-CXCR6 interactions mediate homing of CD8+ T cells into human skin, thereby contributing to psoriasis pathogenesis. PMID: 22113484
  31. Elevated CXCL16/CXCR6 expression in Systemic sclerosis (SSc) serum and on SSc dermal Endothelial cells, respectively, has been observed. PMID: 21303517
  32. High CXCL16/CXCR6 expression may be associated with aggressive cancer behavior, while high CXCL16 expression may be linked to bone metastases. PMID: 21468586
  33. CXCR6 plays a role in aggressive tumor phenotype in melanoma. PMID: 21203549
  34. The CXCL16 A181V mutation selectively inhibits monocyte adhesion to CXCR6 but is not associated with human coronary heart disease. PMID: 21233446
  35. CXCR6 protein was detected in all clinical prostate cancer samples. Both PC3 and LNCap cells expressed CXCR6 mRNA and protein. PMID: 20646641
  36. The statistical significance, replication, and magnitude of the association suggest that CXCR6 is likely involved in the molecular etiology of AIDS, particularly in long-term nonprogression. PMID: 20704485
  37. Data suggests that CXCL16 and CXCR6 may mark cancers arising in an inflammatory milieu and mediate pro-tumorigenic effects of inflammation through impacts on cancer cell growth and by inducing the migration and proliferation of tumor-associated leukocytes. PMID: 19690611
  38. Chemokine receptor expression on MBP-reactive T cells: CXCR6 is a marker of IFNgamma-producing effector cells. PMID: 12044980
  39. CCR1, CCR6, and CXCR6 are preferentially expressed by the low cytokine-producing CD8 and CD4(-)CD8(-) subsets of natural killer T-cells. PMID: 12070001
  40. An association exists between CXCR6 genotype and progression from Pneumocystis carinii pneumonia to death in African-Americans with AIDS. PMID: 12761559
  41. CXCR6 expression is down-regulated, independent of CCR5 or CD69 expression and of cytokine induction, by T cell activation signals that involve predominantly the Ca(2+)-dependent calcineurin pathway. PMID: 12914753
  42. The chemokine domain of SR-PSOX/CXCL16 mediated the adhesion of CXCR6-expressing cells, which was not impaired by treatment with pertussis toxin and was up-regulated by treatment of SR-PSOX/CXCL16-expressing cells with a metalloprotease inhibitor. PMID: 14634054
  43. HIV-2 isolates from aviremic and viremic individuals commonly use CCR5, GPR15, and CXCR6 as coreceptors. PMID: 15650194
  44. Immunohistochemistry revealed CXCR6 protein predominantly localized in normal colorectal epithelial cells and some scattered stromal cells. No or weak expression was found in cancerous tissue. PMID: 15736401
  45. Chemokine receptor CXCR6 was overexpressed in Th1 and Tc1 T lymphocytes compared to peripheral blood lymphocytes in Graves disease. PMID: 15817921
  46. CXCR6 was expressed more frequently on synovial T cells than in peripheral blood. PMID: 16200580
  47. LPS upregulates CXCR6 mRNA, protein, & surface expression in human aortic smooth muscle cells. Inhibition of TLR4 blocked LPS-mediated CXCR6 expression. LPS stimulated both AP-1 (c-Fos, c-Jun) and NF-kappaB (p50 and p65) activation. PMID: 16870145
  48. T cells expressing CCR6, CXCR3, and CXCR6 act coordinately with respective ligands and Th1 inflammatory cytokines in the alveolitic/granuloma phases of the disease. PMID: 17615381
  49. Data show that CC chemokine receptor 5 and CXC chemokine receptor 6 expression by lung CD8+ cells correlates with chronic obstructive pulmonary disease severity. PMID: 17640964
  50. HIV-1 infected patients with initial viral load suppression due to HAART showed a faster virologic failure in the presence of the CXCR6-3K allele. PMID: 17725420

Show More

Hide All

Database Links

HGNC: 16647

OMIM: 605163

KEGG: hsa:10663

STRING: 9606.ENSP00000304414

UniGene: Hs.34526

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in lymphoid tissues and activated T cells.

Q&A

What is CXCR6 and what are its primary biological functions?

CXCR6 (C-X-C Motif Chemokine Receptor 6) is a G protein-coupled receptor that serves as the receptor for the chemokine CXCL16. It is predominantly expressed on immune cells, particularly T cells and NK cells. CXCR6 plays several critical biological roles:

  • Acts as a receptor for the C-X-C chemokine CXCL16

  • Serves as an entry coreceptor used by HIV-1 and SIV to enter target cells, in conjunction with CD4

  • Controls the localization of resident memory T lymphocytes in lung compartments

  • Mediates recruitment and positioning of activated CD8+ T cells in inflammatory tissues

  • Maintains airway resident memory T lymphocytes, which are important for defense against respiratory pathogens

The CXCR6/CXCL16 axis is involved in various immunological processes including cell migration, adhesion, and immune surveillance, making it a focus of both basic immunology and translational research.

What cell types express CXCR6 and how can this expression be detected?

CXCR6 shows a distinctive expression pattern across different immune cell populations:

Primary CXCR6-expressing cells:

  • Intratumoral CD8+ T cells (exclusive expression in many cancer types)

  • Hepatic NK cells (35-55% of hepatic NK cells vs. only 3-5% of splenic NK cells)

  • T cells (predominantly activated/memory subsets)

  • NKT cells

Detection methods:

  • Flow cytometry: Most commonly used for cellular phenotyping, using anti-CXCR6 antibodies such as PE-conjugated monoclonal antibodies

  • Real-time PCR: For quantifying CXCR6 transcript levels using primers (Forward: 5′-CCCTGTACTTTATGCCTTTG-3′; Reverse: 5′-CTTGGAACTGTCCTCAGAAG-3′)

  • Single-cell RNA sequencing: For detailed analysis of expression patterns across cell subpopulations

  • Immunohistochemistry: For tissue localization studies

Example flow cytometry protocol:

  • Isolate cells from tissue of interest (e.g., tumor, liver, PBMCs)

  • Stain with fluorophore-conjugated anti-CXCR6 antibody (e.g., Mouse Anti-Human CXCR6 PE-conjugated Monoclonal Antibody)

  • Co-stain with lineage markers (e.g., CD3, CD8, NK1.1)

  • Analyze using standard flow cytometry techniques with appropriate controls

What experimental models are available for studying CXCR6 function?

Several experimental models have been established to study CXCR6 function:

Mouse models:

  • Cxcr6^-/-^ knockout mice: Complete CXCR6 deficiency

  • Cxcr6^+/-^ heterozygous mice: One allele of Cxcr6 replaced with GFP, allowing visualization of CXCR6-expressing cells

  • Rag1^-/-^Cxcr6^-/-^ double knockout mice: Lack T and B cells in addition to CXCR6 deficiency, useful for studying NK cell-specific functions

  • Transgenic Cxcr6^-/-^ OT-I mice: For studying antigen-specific T cell responses

In vitro systems:

  • CXCR6 transfection systems in cell lines (e.g., HEK293)

  • Primary human PBMC cultures with CXCR6 analysis

  • Trans-well migration assays to assess CXCR6-dependent chemotaxis

  • Organoid cultures with CXCR6-expressing immune cells

Disease models:

  • Tumor models: Various transplantable tumor lines (e.g., Panc02-OVA, E.G7-OVA) for studying CXCR6 in cancer immunity

  • Patient-derived organoids and xenografts expressing CXCL16

  • Contact hypersensitivity (CHS) models for studying CXCR6 in inflammatory responses

  • Viral infection models for studying CXCR6 in antiviral immunity

How can researchers effectively modify CXCR6 expression for adoptive cell therapy approaches?

Modifying CXCR6 expression has shown promising results for enhancing adoptive cell therapy efficacy, particularly for solid tumors. Here's a methodological approach:

Viral vector-based CXCR6 transduction:

  • Vector design: Design retroviral or lentiviral vectors containing the CXCR6 gene, optimally with a marker gene (e.g., GFP) for tracking transduced cells

  • T cell isolation: Isolate primary T cells from peripheral blood or tumor-infiltrating lymphocytes

  • Activation: Activate T cells with anti-CD3/CD28 antibodies and IL-2 (typically 150 ng/mL)

  • Transduction: Co-transduce cells with both CXCR6 and a tumor-specific TCR or CAR

  • Verification: Confirm expression using flow cytometry and functional assays

  • Expansion: Expand cells under conditions that maintain CXCR6 expression

Key considerations:

  • Co-expression of CXCR6 with a tumor-specific TCR or CAR has shown synergistic effects in enhancing T cell trafficking to CXCL16-expressing tumors

  • CXCR6 enhances T cell adhesion to cancer cells through interaction with CXCL16, improving tumor recognition and killing

  • In experimental models, CXCR6-transduced antigen-specific T cells demonstrated significantly enhanced migration to CXCL16-expressing tumors

Experimental results from published studies:

  • Co-transduction of CXCR6 with a mesothelin-specific CAR enabled effective T cell migration toward CXCL16-producing human pancreatic cancer cells

  • CXCR6-transduced OT-1 T cells mediated complete tumor rejection in 4 out of 5 mice in the E.G7-OVA-CXCL16 lymphoma model

  • The combination of CXCR6 with an anti-EpCAM-CAR achieved prolonged tumor control and tumor rejection in 4 out of 5 mice with Panc02-OVA-EpCAM tumors

This approach has shown particular promise for pancreatic cancer, where CXCL16 is highly expressed by both cancer cells and tumor-infiltrating immune cells .

What methodologies are optimal for investigating CXCR6's role in immune cell positioning within the tumor microenvironment?

CXCR6 plays a critical role in positioning immune cells within the tumor microenvironment. The following methodologies are valuable for studying this function:

Imaging techniques:

  • Multiphoton intravital microscopy (MP-IVM): Allows real-time visualization of CXCR6+ cell movement within tumors; has been used to demonstrate that CXCR6 optimizes positioning of TCF-1neg CTL in perivascular clusters of DC3 in tumor stroma

  • Confocal microscopy: For evaluating CXCR6-dependent adhesion of T cells to tumor cells

  • Immunofluorescence tissue imaging: For mapping spatial distribution of CXCR6+ cells relative to other cell types

Functional assays:

  • Adhesion assays: To quantify CXCR6-mediated binding to CXCL16-expressing cells

    • Protocol demonstrated that CXCR6-transduced T cells show preferential adhesion to tumor cells that can be blocked by anti-CXCL16 neutralizing antibody

  • Transwell migration assays: To assess chemotactic responses to CXCL16 gradients

  • In vivo tracking: Using CXCR6-GFP reporter systems to track cell movement

Molecular and cellular approaches:

  • Single-cell spatial transcriptomics: To map expression patterns of CXCR6, CXCL16, and related genes within the tumor microenvironment

  • CRISPR-Cas9 gene editing: For creating precise modifications to study structure-function relationships

  • Adoptive transfer experiments: Comparing trafficking of wild-type versus CXCR6-deficient cells

    • Short-term (6-hour) recruitment assays have demonstrated a 33% reduction in liver localization of CXCR6-/- CD8+ T cells compared to wild-type

Key findings and considerations:

  • CXCR6 promotes direct T cell adhesion to cancer cells, enhancing tumor cell recognition and killing

  • CXCR6+ CD8+ T cells show improved accumulation at tumor sites, with CXCR6 deficiency resulting in reduced infiltration

  • CXCL16+ macrophages and dendritic cells recruit CXCR6+ T and NK cells, which exhibit enhanced cytotoxicity

How does CXCR6 expression influence response to immune checkpoint inhibitors and what are the methodological approaches to study this relationship?

CXCR6 expression has emerged as a potential biomarker for response to immune checkpoint inhibitors. Here are methodological approaches to investigate this relationship:

Clinical correlation studies:

Experimental approaches:

  • In vivo models using CXCR6-deficient mice:

    • Cxcr6-/- mice showed impaired response to anti-PD-1 treatment

    • Experimental protocol: Establish tumors in wild-type and CXCR6-deficient mice, treat with anti-PD-1 antibodies, and compare tumor growth and survival

  • Mechanistic studies:

    • Analyze impact of CXCR6 deficiency on immune cell infiltration, activation, and function after checkpoint blockade

    • Study how CXCR6 affects the spatial distribution of immune cells in responders versus non-responders

Biomarker development:

  • Multiparameter analysis: Combine CXCR6 expression with other known biomarkers

    • CXCR6 expression is positively correlated with established immunotherapy biomarkers:

      • CD8A expression

      • Effector T cell signature

      • PD-L1 (CD274) expression

  • Immune phenotyping: Categorize tumors based on CXCR6 expression and immune infiltration patterns

    • High CXCR6 expression is significantly associated with the "inflamed" immune phenotype, which responds more favorably to immunotherapy

Data from clinical studies:

These findings suggest that CXCR6 could serve as both a prognostic biomarker and a predictive marker for immunotherapeutic response in multiple cancer types .

What approaches are most effective for studying the CXCR6-CXCL16 axis in different disease models?

The CXCR6-CXCL16 axis is involved in various disease processes. Here are effective approaches for studying this pathway across different models:

Cancer models:

  • Genetic approaches:

    • Generate tumor lines with modulated CXCL16 expression (knockdown or overexpression)

    • Use CXCR6-deficient mouse models to study tumor growth and immune infiltration

  • Therapeutic interventions:

    • Neutralizing antibodies against CXCL16 or CXCR6

    • Small molecule inhibitors of CXCR6 signaling

  • Analysis techniques:

    • Multiplex immunohistochemistry to map CXCR6+ and CXCL16+ cells

    • Flow cytometry to characterize immune infiltrates

    • scRNA-seq to identify cell populations involved in the axis

Viral infection models:

  • Hepatotropic virus models:

    • Use CXCR6-reporter systems to track memory NK cells after viral challenge

    • Employ neutralizing antibodies against CXCR6 before viral challenge

    • Results show CXCR6 is essential for NK cell-mediated antiviral immunity regardless of virus type or genetic background

  • HIV/SIV models:

    • Study CXCR6 as a co-receptor for viral entry

    • Develop and test entry inhibitors targeting CXCR6

Inflammation and autoimmunity models:

  • Contact hypersensitivity (CHS):

    • Use hapten sensitization and challenge in CXCR6-deficient mice

    • Adoptive transfer of CXCR6+ versus CXCR6- cells

    • CHS responses were abolished after CXCR6 blockade regardless of the type of antigen

  • Graft-versus-host disease (GvHD):

    • Transfer CXCR6-deficient lymphocytes into recipients to study hepatic infiltration

    • Short-term (6-hour) recruitment assays show 33% reduction in liver localization of CXCR6-/- CD8+ T cells

Technical considerations:

  • Chemotaxis assays:

    • Use Transwell systems with recombinant CXCL16 at optimal concentrations

    • Include polystyrene beads as internal standards for quantification

  • CXCR6-CXCL16 interaction analysis:

    • Surface plasmon resonance for binding kinetics

    • Calcium flux assays for receptor activation

  • CXCL16 detection:

    • Both membrane-bound and soluble forms must be assessed

    • ELISA for soluble CXCL16 in supernatants or plasma

    • Flow cytometry for membrane-bound CXCL16

How can single-cell RNA sequencing data be leveraged to understand CXCR6's function in different immune cell populations?

Single-cell RNA sequencing (scRNA-seq) has emerged as a powerful tool for understanding CXCR6 biology across immune cell subsets. Here's a methodological framework:

Data generation and preprocessing:

  • Sample preparation: Isolate cells from tissues of interest (tumors, inflamed tissues, blood)

  • Sequencing platform selection: 10x Genomics, Smart-seq2, or other platforms depending on depth versus throughput needs

  • Quality control: Filter low-quality cells and normalize expression data

  • Dimensionality reduction: Apply techniques like PCA, t-SNE, or UMAP to visualize data

Analysis approaches:

  • Cell type identification:

    • Identify CXCR6-expressing populations using unsupervised clustering

    • Use known cell type markers to annotate clusters

    • Studies have shown CXCR6 is predominantly expressed in T and NK cells

  • Expression pattern analysis:

    • Map CXCR6 expression across cell types and activation states

    • Correlate with CXCL16 expression to identify potential interaction nodes

    • Research has demonstrated that CXCR6 facilitates T/NK-myeloid interaction via the CXCR6-CXCL16 axis

  • Trajectory analysis:

    • Reconstruct developmental trajectories to determine when CXCR6 is upregulated

    • Data shows CXCR6 is upregulated on PD-1+ TCF-1neg CTL in tumor-draining lymph nodes

  • Receptor-ligand interaction analysis:

    • Use computational tools (e.g., CellPhoneDB, NicheNet) to predict CXCR6-CXCL16 interactions between cell types

    • Analysis has revealed that CXCL16+ macrophages and dendritic cells recruit CXCR6+ T and NK cells

Integration with other data types:

  • Spatial transcriptomics:

    • Map CXCR6+ cells within tissue architecture

    • Correlate with functional outcomes

  • Multi-omics integration:

    • Combine with ATAC-seq to analyze chromatin accessibility at the CXCR6 locus

    • Integrate with proteomics data to confirm expression at protein level

Functional interpretation:

  • Gene set enrichment analysis:

    • Identify pathways enriched in CXCR6+ versus CXCR6- cells

    • Research shows CXCR6+ CD8+ T cells are more immunocompetent

  • Novel cell state identification:

    • Discover previously unrecognized immune cell states based on CXCR6 co-expression patterns

    • Studies have identified CXCR6 as critical for rescuing proliferative transitory CTL subsets from activation-induced cell death through exposure to trans-presented IL-15

These approaches have led to important discoveries, such as the identification of CXCR6 as the most highly expressed chemokine receptor in tumor-infiltrating CTL, and DC3 as the cell state most highly expressing its ligand CXCL16 .

What are the key experimental challenges in evaluating CXCR6's role in memory T and NK cell responses, and how can they be addressed?

CXCR6 plays a crucial role in memory formation and maintenance in both T and NK cells, but studying this function presents specific challenges:

Challenge 1: Distinguishing memory formation from maintenance

  • Methodological solution: Use temporal blocking/deletion of CXCR6

    • Administer anti-CXCR6 antibody at different timepoints after primary challenge

    • Use inducible CXCR6 knockout systems

    • Research has shown that when sensitized mice were given neutralizing anti-CXCR6 before hapten challenge, CHS responses were abolished in Rag1-/- mice

Challenge 2: Tissue-specific roles of CXCR6

  • Methodological solution: Tissue-specific analysis and perturbation

    • Use tissue-resident immune cell isolation protocols (avoiding contamination)

    • Perform parabiosis experiments to distinguish resident from circulating cells

    • Studies have demonstrated that 35-55% of hepatic NK cells express CXCR6, compared to only 3-5% of splenic NK cells

Challenge 3: Separating CXCR6's effects on trafficking versus function

  • Methodological solution: Combined in vivo imaging and functional assays

    • Use dual-reporter systems to track both CXCR6 expression and functional markers

    • Perform short-term (6-hour) recruitment assays to isolate trafficking effects

    • Research has demonstrated a 33% reduction in liver localization of CXCR6-/- CD8+ cells compared to wild-type, while blood frequencies remained similar

Challenge 4: Heterogeneity within CXCR6+ populations

  • Methodological solution: Single-cell approaches

    • Sort CXCR6+ cells based on expression level (high, intermediate, low)

    • Perform scRNA-seq on sorted populations

    • Use adoptive transfer of defined subsets to test functionality

    • Data shows CXCR6-intermediate, mostly TCF-1neg CTL emerged in the blood of tumor-bearing animals

Challenge 5: Long-term fate mapping of CXCR6+ cells

  • Methodological solution: Lineage tracing approaches

    • Generate CXCR6-fate mapping mouse models

    • Use stable barcoding techniques for clonal analysis

    • Studies have shown CXCR6+ hepatic NK cells persisted unchanged for at least 6 weeks after transfer

Challenge 6: Evaluating antigen specificity of CXCR6+ memory cells

  • Methodological solution: Combine CXCR6 analysis with antigen-specific tools

    • Use MHC tetramers or dextramers to identify antigen-specific cells

    • Engineer CXCR6-/- antigen-specific T cells (e.g., OT-I)

    • Research has shown induced CXCR6+CD8+ T cells possessed tumor antigen specificity and enhanced anti-PD-1 efficacy

Addressing these challenges has led to important insights, including the discovery that CXCR6 is essential for NK cell memory of haptens and viruses, being required for the persistence of memory NK cells but not their priming or effector functions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.