Recombinant Human C2 domain-containing protein 2-like (C2CD2L)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human C2 domain-containing protein 2-like (C2CD2L) is a lipid-binding protein that facilitates the transport of phosphatidylinositol, a precursor of phosphatidylinositol 4,5-bisphosphate (PI(4,5)P2) . C2CD2L, also known as TMEM24, interacts with insulin and plays a role in glucose-stimulated insulin secretion in pancreatic islets . C2CD2L mediates endoplasmic reticulum (ER) and plasma membrane contacts, activates the AKT-mTOR pathway, and regulates cell growth and protein synthesis .

Expression and Localization

C2CD2L is broadly expressed in all tissues . It is highly expressed in the brain and pancreatic islets . C2CD2L is a membrane protein anchored to the endoplasmic reticulum .

Role in Triple-Negative Breast Cancer

Table 1: Impact of C2CD2L on TNBC Cell Behavior

Regulatory Mechanisms

AC112721.1 upregulates C2CD2L expression by acting as a ceRNA, sponging miR-491-5p . This interaction promotes the proliferation and migration of TNBC cells while inhibiting apoptosis .

Table 2: Regulation of C2CD2L by AC112721.1 and miR-491-5p

RegulatorEffect on C2CD2L ExpressionImpact on TNBC Progression
AC112721.1UpregulatesPromotes proliferation and migration, inhibits apoptosis
miR-491-5pDownregulatesInhibits proliferation and migration, promotes apoptosis (antagonized by AC112721.1)

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If a particular tag is required, please inform us, and we will prioritize its incorporation.
Synonyms
C2CD2L; KIAA0285; TMEM24; DLNB23; Phospholipid transfer protein C2CD2L; C2 domain-containing protein 2-like; C2CD2-like; Transmembrane protein 24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-706
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
C2CD2L
Target Protein Sequence
MDPGWGQRDVGWAALLILFAASLLTVFAWLLQYARGLWLARARGDRGPGPALAGEPAGSL RELGVWRSLLRLRATRAGAAEEPGVRGLLASLFAFKSFRENWQRAWVRALNEQACRNGSS IQIAFEEVPQLPPRASISHVTCVDQSEHTMVLRCQLSAEEVRFPVSVTQQSPAAVSMETY HVTLTLPPTQLEVNLEEIPGEGLLISWAFTDRPDLSLTVLPKLQARERGEEQVELSTIEE LIKDAIVSTQPAMMVNLRACSAPGGLVPSEKPPMMPQAQPAIPRPNRLFLRQLRASHLGN ELEGTEELCCVAELDNPMQQKWTKPARAGSEVEWTEDLALDLGPQSRELTLKVLRSSSCG DTELLGQATLPVGSPSRPLSRRQLCPLTPGPGKALGPAATMAVELHYEEGSPRNLGTPTS STPRPSITPTKKIELDRTIMPDGTIVTTVTTVQSRPRIDGKLDSPSRSPSKVEVTEKTTT VLSESSGPSNTSHSSSRDSHLSNGLDPVAETAIRQLTEPSGRVAKKTPTKRSTLIISGVS KVPIAQDELALSLGYAASLEASVQDDAGTSGGPSSPPSDPPAMSPGPLDALSSPTSVQEA DETTRSDISERPSVDDIESETGSTGALETRSLKDHKVSFLRSGTKLIFRRRPRQKEAGLS QSHDDLSNATATPSVRKKAGSFSRRLIKRFSFKSKPKANGNPSPQL
Uniprot No.

Target Background

Function
C2CD2L (TMEM24) is a lipid-binding protein that transports phosphatidylinositol, the precursor of phosphatidylinositol 4,5-bisphosphate (PI(4,5)P2), from its endoplasmic reticulum synthesis site to the cell membrane. This maintains the cell membrane phosphoinositide pool, crucial substrates degraded during phospholipase C (PLC) signaling. C2CD2L plays a key role in coordinating Ca2+ and phosphoinositide signaling by localizing to endoplasmic reticulum-cell membrane contact sites, where it tethers the bilayers. Cytosolic Ca2+ elevation triggers C-terminal phosphorylation, leading to membrane dissociation and cessation of phosphatidylinositol transport. Furthermore, C2CD2L positively regulates glucose-stimulated insulin secretion by enabling PI(4,5)P2 pool replenishment and calcium channel opening, thus priming insulin granule release.
Gene References Into Functions
  1. TMEM24 deficiency abolishes calcium oscillations, resulting in impaired triggered insulin release. PMID: 28209843
  2. This study details the tissue distribution, interaction partners, and pathways involving C2CD2L. It demonstrates that C2CD2L interacts with insulin and plays a role in glucose-stimulated insulin secretion within pancreatic islets. Protein-level analysis reveals enriched expression in pancreatic islets and the brain. PMID: 24012759
Database Links

HGNC: 29000

OMIM: 617582

KEGG: hsa:9854

UniGene: Hs.26899

Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Cell membrane; Peripheral membrane protein.

Q&A

What is the domain structure of C2CD2L/TMEM24?

C2CD2L/TMEM24 contains four distinct functional domains that enable its role as both a membrane tether and lipid transporter:

  • N-terminal transmembrane domain (anchors protein to the ER membrane)

  • Synaptotagmin-like mitochondrial lipid-binding (SMP) domain (mediates lipid transport)

  • C2 domain (involved in protein-protein interactions)

  • C-terminal region with polybasic motifs (interacts with plasma membrane)

The C-terminal region contains serine residues interspersed within polybasic motifs that become phosphorylated in response to calcium elevation, regulating the protein's association with the plasma membrane . AlphaFold prediction identifies a β-sheet structure in this region that is necessary for plasma membrane localization .

How does C2CD2L differ from its paralog C2CD2?

While C2CD2L and C2CD2 share the same domain organization, they differ in several important aspects:

Despite these differences, the SMP domains of C2CD2L and C2CD2 can heterodimerize when co-expressed, suggesting potential functional interactions in tissues where both proteins are expressed .

What is the cellular localization of C2CD2L?

C2CD2L exhibits a dynamic subcellular localization pattern:

  • Primarily localizes to sites of contact between the endoplasmic reticulum (ER) and plasma membrane (PM)

  • Anchored to the ER membrane via its N-terminal transmembrane domain

  • Enriched at ER-PM junctions near sites of cell-cell contacts through interactions with band 4.1 family members

Interestingly, C2CD2L at cell-adjacent ER-PM junctions is not released from the PM by calcium rise, unlike C2CD2L at non-cell adjacent junctions, indicating differential regulation based on cellular context .

What is the role of C2CD2L in phospholipid transport?

C2CD2L functions as a lipid transport protein with several critical roles:

  • Transports phosphatidylinositol (PI) from its site of synthesis in the ER to the plasma membrane

  • Maintains the pool of plasma membrane phosphoinositides, which are critical for signaling

  • Supports the replenishment of phosphatidylinositol 4,5-bisphosphate (PI(4,5)P2) pools after phospholipase C signaling

  • Coordinates phosphoinositide metabolism with calcium signaling

The SMP domain of C2CD2L forms a hydrophobic cavity that can accommodate glycerophospholipids, allowing it to extract and transfer these lipids between membranes. When calcium levels rise, C2CD2L dissociates from the PM, temporarily halting PI transport and limiting the replenishment of PI(4,5)P2 pools .

How is C2CD2L regulated by calcium signaling?

C2CD2L regulation by calcium signaling represents a sophisticated feedback mechanism:

  • In resting conditions (low cytosolic Ca²⁺), C2CD2L localizes to ER-PM contacts where it transports phosphatidylinositol to the PM .

  • When cytosolic Ca²⁺ levels rise:

    • Calcium-dependent protein kinase C (PKC) is activated

    • PKC phosphorylates multiple serine residues in the C-terminal region of C2CD2L

    • These phosphorylated serines disrupt binding to the PM

  • This causes C2CD2L to dissociate from the PM and redistribute throughout the ER, temporarily halting phosphatidylinositol transport .

  • As Ca²⁺ levels decrease:

    • Phosphatases dephosphorylate C2CD2L

    • C2CD2L re-associates with the PM

    • Phosphatidylinositol transport resumes

This creates a negative feedback loop where Ca²⁺ signaling temporarily halts the delivery of new PI to the PM, limiting PI(4,5)P2 replenishment and moderating subsequent Ca²⁺ signals .

How does C2CD2L contribute to insulin secretion in pancreatic β-cells?

C2CD2L plays a critical role in regulating glucose-stimulated insulin secretion through its lipid transport function:

  • Mechanistic role:

    • Transports phosphatidylinositol (PI) from the ER to the plasma membrane

    • This PI serves as a precursor for PI(4,5)P2 synthesis

    • PI(4,5)P2 is essential for proper calcium channel function and exocytosis

    • By maintaining PM phosphoinositide pools, C2CD2L supports calcium influx and insulin granule priming

  • Dynamic regulation:

    • During glucose stimulation, calcium levels in β-cells oscillate

    • When calcium rises, C2CD2L is phosphorylated and temporarily dissociates from the PM

    • This creates a negative feedback loop that modulates calcium signaling

    • As calcium levels decrease, C2CD2L returns to ER-PM contacts and resumes PI transport

Studies of TMEM24 knockout in insulinoma cells have shown defects in calcium oscillations . Different insulin granules have different calcium responsiveness, and C2CD2L helps maintain glucose homeostasis by fine-tuning insulin release .

What experimental approaches are effective for studying C2CD2L at ER-PM junctions?

Several complementary techniques have proven valuable for investigating C2CD2L function:

  • Proximity labeling methods:

    • APEX2-based proximity biotinylation has been successfully used to identify C2CD2L interactors

    • This approach generates rapidly diffusing biotin radicals that label proteins within ~20nm

    • Labeled proteins are purified via streptavidin and identified by mass spectrometry

  • Domain mapping and mutation analysis:

    • Truncation mutants to identify functional domains

    • Phosphomimetic mutations (S→E) to study regulation by phosphorylation

    • Internal deletion constructs to identify critical structural elements

  • Liposome-based assays:

    • Tethering assays using liposomes of different compositions (ER-like vs. PM-like)

    • Lipid transfer assays to measure transport activity

  • Live-cell imaging:

    • Fluorescently tagged C2CD2L to track localization during calcium oscillations

    • Calcium imaging to correlate Ca²⁺ dynamics with C2CD2L redistribution

  • Heterologous expression systems:

    • HEK293 cells for full-length protein expression

    • Cell-free protein synthesis for certain constructs

These approaches have collectively revealed C2CD2L's dynamic localization, regulation by calcium, and interactions with other proteins at ER-PM junctions.

What is the significance of SMP domain dimerization in C2CD2L function?

The SMP domain plays a crucial role in C2CD2L function through dimerization:

  • Structural significance:

    • SMP domains form dimers, creating an extended hydrophobic cavity capable of accommodating glycerophospholipids

    • This tube-like structure facilitates extraction and transport of lipids between membranes

  • Heterodimerization with C2CD2:

    • The SMP domains of C2CD2L and C2CD2 can heterodimerize

    • This was demonstrated through co-expression and co-purification experiments

    • Size-exclusion chromatography of co-expressed SMP domains shows co-elution at the expected molecular weight of dimers

  • Functional implications:

    • Dimerization enhances lipid binding capacity by creating a larger hydrophobic pocket

    • Heterodimerization could create complexes with hybrid properties in tissues where both proteins are expressed

    • This adds complexity to C2CD2L regulation through differential expression of paralogs

The ability to form both homodimers and heterodimers with C2CD2 suggests evolutionary pressure to maintain this feature, highlighting its importance for lipid transport function.

How can recombinant C2CD2L be optimally expressed and purified?

Based on published research, several expression systems and purification strategies have been employed:

  • Expression systems:

    • Mammalian cell lines (HEK293) are preferred for full-length C2CD2L expression

    • Bacterial expression systems have been used for individual domains (like the SMP domain)

    • Cell-free protein synthesis has also been reported

  • Construct design considerations:

    • Full-length protein (AA 1-706) or specific domains depending on research question

    • Various fusion tags for detection and purification (His, Strep, GST, etc.)

    • For membrane protein studies, careful signal peptide design is critical

  • Purification protocols:

    • One-step affinity chromatography using fusion tags

    • Size exclusion chromatography (SEC) for higher purity

    • Quality control by SDS-PAGE, Western blot, and analytical SEC

Commercial recombinant human C2CD2L expressed in HEK-293 cells with a His tag has achieved >90% purity as determined by Bis-Tris PAGE, anti-tag ELISA, Western Blot and analytical SEC .

What are the methodological challenges in studying C2CD2L protein-protein interactions?

Investigating C2CD2L interactions presents several technical challenges:

  • Membrane association complications:

    • C2CD2L is anchored to the ER membrane, complicating traditional interaction studies

    • Detergent solubilization can disrupt native interactions or create artifacts

    • The protein's dynamic localization between different membrane domains adds complexity

  • Context-dependent interactions:

    • Interactions at cell-cell contacts differ from those at other ER-PM junctions

    • Many interactions may be calcium-dependent or phosphorylation-dependent

    • Temporal dynamics during calcium oscillations are difficult to capture

  • Technical limitations:

    • Traditional co-immunoprecipitation may miss transient or weak interactions

    • Proximity labeling methods provide better coverage but may give false positives

    • Cross-linking approaches introduce potential artifacts

Successful strategies have included:

  • APEX2-based proximity biotinylation for identifying interaction partners at ER-PM junctions

  • Domain-specific truncation studies to map interaction interfaces

  • Comparative analysis between C2CD2L and C2CD2 to identify paralog-specific interactions

How does C2CD2L-mediated lipid transport differ in neurons versus other cell types?

C2CD2L exhibits several neuron-specific characteristics:

  • Expression pattern:

    • Highly enriched in neurons versus glial cells

    • Expression increases with neuronal differentiation

    • Significantly higher levels in brain tissue compared to other tissues

  • Neuronal specificity:

    • Neurons have abundant ER-PM contacts, particularly in dendrites and near synapses

    • At these contacts, C2CD2L colocalizes with Kv2 channels (major delayed rectifier K⁺ channels in brain)

    • This suggests a potential regulatory feedback between neuronal excitability and lipid exchange

  • Cell-specific interactions:

    • In neurons, C2CD2L may interact with neuron-specific proteins

    • Recent research indicates enrichment at cell-cell contacts, which in neurons could correspond to synaptic regions

    • These interactions may differ from those in pancreatic β-cells or other cell types

  • Functional significance:

    • In neurons, C2CD2L responds to both experimental manipulations and spontaneous activity

    • This links lipid transport directly to neuronal activity patterns

    • The high sensitivity to calcium elevations appears specially adapted to support neuronal signaling functions

The different tissue distribution of C2CD2L (brain-enriched) versus C2CD2 (broadly expressed) suggests evolutionary specialization of these paralogs for tissue-specific functions .

What are the potential implications of C2CD2L in neurological or metabolic disorders?

While direct links to specific disorders aren't extensively characterized in the available research, C2CD2L's functions suggest potential implications:

  • Neurological considerations:

    • C2CD2L's enrichment in neurons and role in calcium-phosphoinositide signaling suggests potential involvement in:

      • Disorders characterized by calcium dysregulation

      • Synaptic dysfunction disorders

      • Conditions involving ER stress or lipid metabolism abnormalities

  • Metabolic implications:

    • Role in insulin secretion suggests potential involvement in:

      • Diabetes or insulin resistance mechanisms

      • Disorders of glucose homeostasis

      • Pancreatic β-cell dysfunction

  • Research approaches to investigate these links:

    • Expression analysis in patient samples or disease models

    • Genetic association studies

    • Conditional knockout models to assess tissue-specific effects

    • Drug screening for compounds that modulate C2CD2L function

Recent studies using proximity labeling have identified C2CD2L interactions with proteins like MACO-1, which are implicated in cell signaling platforms relevant to cell fate determination, suggesting broader roles in cellular homeostasis .

What is known about C2CD2L's role at cell-cell contacts?

Recent research has revealed a novel role for C2CD2L at cell-cell contacts:

  • Localization pattern:

    • C2CD2L-containing ER-PM junctions are enriched at sites of cell-cell contacts

    • This enrichment is significantly higher than at non-cell adjacent regions

  • Protein interactions:

    • C2CD2L forms a complex with band 4.1 family members

    • These band 4.1 proteins in turn bind PM proteins including cell adhesion molecules such as SynCAM 1

    • APEX2 proximity biotinylation has been used to identify these interaction partners

  • Functional significance:

    • C2CD2L at cell-adjacent contacts behaves differently than at non-cell adjacent sites

    • Unlike other locations, C2CD2L at cell-cell contacts is not shed from the PM during calcium rise

    • This suggests compartmentalized regulation of lipid transport at these sites

  • Structural requirements:

    • An internal deletion of the first three strands of the β-sheet in combination with phosphomimetic mutations completely disrupts TMEM24's ability to bind the PM

    • The β-sheet appears necessary for localization at sites of cell-cell contacts

This cell-contact-specific behavior suggests C2CD2L may participate in adaptive responses to cell contact-dependent signaling, particularly in neurons where cell-cell contacts include synapses .

How do small molecules and chemical probes affect C2CD2L function?

Developing chemical probes that target C2CD2L function is an emerging area of research:

  • Proteomic approaches:

    • Integrated proteomic workflows have been developed to monitor effects of small molecules on protein-protein interactions

    • These combine co-fractionation mass spectrometry with analysis of covalent protein binding

  • Experimental design:

    • Electrophilic compounds are tested for their effects on protein complexation state

    • SEC fractions from treated and untreated cells are compared using tandem mass tagging (TMT)

    • This allows identification of compounds that affect specific protein-protein interactions

  • Potential applications:

    • Chemical probes could be developed to modulate C2CD2L's:

      • Lipid transport activity

      • Calcium sensitivity

      • Interaction with specific protein partners

    • Such probes would be valuable research tools and potential therapeutic leads

  • Challenges:

    • Achieving specificity for C2CD2L over other lipid transport proteins

    • Targeting specific domains or functions

    • Distinguishing effects on C2CD2L versus its paralog C2CD2

While specific chemical probes for C2CD2L were not explicitly mentioned in the search results, the described proteomic platform represents a promising approach for their development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.