Recombinant Human Calcium-binding mitochondrial carrier protein Aralar1 (SLC25A12)

Shipped with Ice Packs
In Stock

Description

Protein Structure

Aralar1 is a multi-pass transmembrane protein encoded by the SLC25A12 gene (chromosome 2q24) and contains:

  • N-terminal domain: 2 imperfect EF-hand motifs and 3 canonical EF-hand calcium-binding domains .

  • C-terminal domain: Shares 28–29% identity with mitochondrial solute carriers (e.g., SLC25A11, SLC25A5) and contains 6 transmembrane domains .

  • Molecular weight: 74.8 kDa (678 amino acids) .

DomainFunctionReference
N-terminal EF-handsBinds calcium (1 Ca²⁺ ion), regulates conformational changes .
C-terminal coreForms the translocation pathway for glutamate/aspartate exchange .

Transport Mechanism

Aralar1 operates as an antiporter:

  • Substrate exchange: Ca²⁺-dependent transport of glutamate (cytoplasm → mitochondria) and aspartate (mitochondria → cytoplasm) .

  • Regulation: Calcium binding induces conformational changes in the N-terminal domain, opening the C-terminal vestibule for substrate translocation .

Genetic Disorders

Mutations in SLC25A12 are linked to severe neurological and metabolic conditions:

DiseaseKey FeaturesInheritanceReferences
Early Infantile Epileptic Encephalopathy 39 (EIEE39)Global cerebral hypomyelination, refractory seizures, neurodevelopmental delayAutosomal recessive
Autism-related phenotypesOverexpression in prefrontal cortex (BA46), altered neuronal network formationPolymorphisms SNPs in introns 3/16

Metabolic Roles

Aralar1 is integral to:

  • Malate-aspartate shuttle: Transfers reducing equivalents (NADH) from cytosol to mitochondria .

  • Urea cycle: Supplies mitochondrial aspartate for cytosolic urea synthesis .

  • Myelin synthesis: Supports N-acetyl-aspartate production in neurons .

Production Systems

Recombinant Aralar1 is typically produced via:

SystemAdvantagesLimitations
E. coliHigh yield, cost-effectiveRequires refolding; lacks post-translational modifications
Insect cellsProper folding, glycosylation (if applicable)Lower yield, higher cost
Mammalian cellsNative-like folding and activityComplex protocols, scalability issues

Purification often employs His-tag affinity chromatography .

Functional Assays

Recombinant Aralar1 is validated through:

  • Transport activity: Reconstituted into liposomes to measure glutamate/aspartate exchange .

  • Calcium binding: Fluorescence or isothermal titration calorimetry (ITC) assays .

Disease Modeling

ModelKey FindingsReference
EIEE39 patient cellsHypomyelination correlates with impaired Aralar1-mediated aspartate transport
Autism-associated SNPsOverexpression alters glutamate-aspartate cycling in prefrontal neurons

Metabolic Regulation

  • Insulin secretion: Overexpression in pancreatic β-cells enhances mitochondrial metabolism and glucose-stimulated insulin secretion .

  • Urea cycle defects: Loss of Aralar1 disrupts cytosolic aspartate supply, exacerbating hyperammonemia .

Transport Activity

CarrierSubstratesCa²⁺ DependenceTissue Expression
Aralar1 (AGC1)Glutamate/aspartateYesBrain, muscle, heart
Citrin (AGC2)Glutamate/aspartateYesLiver, non-excitable tissues
SLC25A13CitrullineNoLiver

Clinical Mutations

MutationEffectPhenotype
SLC25A12 loss-of-functionImpaired calcium binding, transportEIEE39, hypomyelination
SLC25A12 SNPsAltered neuronal expressionAutism susceptibility

Future Directions

  • Therapeutic targets: Modulating Aralar1 activity to treat metabolic or neurological disorders.

  • Structural studies: Cryo-EM resolution of calcium-bound Aralar1 to elucidate transport mechanisms.

  • Biomarker development: ELISA kits (e.g., mouse-specific ) could be adapted for human diagnostics.

Product Specs

Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock. However, if you have any specific requirements for the format, please indicate them when placing your order. We will prepare the product according to your demand.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference for your own preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
SLC25A12; ARALAR1; Calcium-binding mitochondrial carrier protein Aralar1; Mitochondrial aspartate glutamate carrier 1; Solute carrier family 25 member 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-678
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
SLC25A12
Target Protein Sequence
MAVKVQTTKRGDPHELRNIFLQYASTEVDGERYMTPEDFVQRYLGLYNDPNSNPKIVQLL AGVADQTKDGLISYQEFLAFESVLCAPDSMFIVAFQLFDKSGNGEVTFENVKEIFGQTII HHHIPFNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGL DFSDIMVTIRSHMLTPFVEENLVSAAGGSISHQVSFSYFNAFNSLLNNMELVRKIYSTLA GTRKDVEVTKEEFAQSAIRYGQVTPLEIDILYQLADLYNASGRLTLADIERIAPLAEGAL PYNLAELQRQQSPGLGRPIWLQIAESAYRFTLGSVAGAVGATAVYPIDLVKTRMQNQRGS GSVVGELMYKNSFDCFKKVLRYEGFFGLYRGLIPQLIGVAPEKAIKLTVNDFVRDKFTRR DGSVPLPAEVLAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALNVLRDLGIFGL YKGAKACFLRDIPFSAIYFPVYAHCKLLLADENGHVGGLNLLAAGAMAGVPAASLVTPAD VIKTRLQVAARAGQTTYSGVIDCFRKILREEGPSAFWKGTAARVFRSSPQFGVTLVTYEL LQRWFYIDFGGLKPAGSEPTPKSRIADLPPANPDHIGGYRLATATFAGIENKFGLYLPKF KSPSVAVVQPKAAVAATQ
Uniprot No.

Target Background

Function
Aralar1 is a mitochondrial and calcium-binding carrier protein that facilitates the calcium-dependent exchange of cytoplasmic glutamate with mitochondrial aspartate across the inner mitochondrial membrane. It may play a role in the urea cycle.
Gene References Into Functions
  1. Genetic variations in the SLC25A12 gene have been linked to increased risk for childhood ASD. PMID: 28536923
  2. This review examines the structure and function of AGC1, its regulation by calcium, its dependence on mitochondrial membrane potential, its role in cancer cells, and its tissue specificity. AGC1 is implicated in glutamate-mediated excitotoxicity in neurons. Alterations in the AGC gene or protein have been identified in rare human diseases. PMID: 27132995
  3. Sensitivity analyses, considering only studies with a family-based design, revealed a significant association between autism spectrum disorders and SNPs rs2292813 and rs2056202. In contrast, analyses including case-control studies only failed to find a significant association. PMID: 25663199
  4. The SNPs rs2056202 and rs2292813 within SLC25A12 may contribute significantly to the risk of developing autism spectrum disorders. PMID: 25921325
  5. The structures of the calcium-bound and calcium-free N- and C-terminal domains have been elucidated, providing insight into the mechanism of calcium regulation. PMID: 25410934
  6. This review explores the physiological roles of AGC1, its links to calcium homeostasis, and its potential involvement in the pathogenesis of autism. PMID: 21691713
  7. This study did not find any differences in the allele, genotype, or haplotype frequencies of these two SNPs between patients and controls. PMID: 19913066
  8. Variants of the AGC1-encoding SLC25A12 gene were not correlated with AGC activation or associated with autism-spectrum disorders in 309 simplex and 17 multiplex families. PMID: 18607376
  9. The SLC25A12 gene has been linked to autism. PMID: 15056512
  10. Aralar1 has a role in determining glucose metabolic fate, mitochondrial activity, and insulin secretion in beta cells. PMID: 15494407
  11. These findings suggest that SLC25A12 may not be a major contributor to autism risk in these families. PMID: 16648338
  12. It is unlikely that the SLC25A12 polymorphisms investigated play a significant role in conferring susceptibility to schizophrenia. PMID: 17693006
  13. The rs2056202 polymorphism in SLC25A12 may be associated with levels of routines and rituals in autism and related disorders. PMID: 17894412
  14. SLC25A12 expression is associated with neurite outgrowth and is upregulated in the prefrontal cortex of autistic subjects. PMID: 18180767
  15. The SLC25A12 gene has been associated with autism. PMID: 19360665

Show More

Hide All

Database Links

HGNC: 10982

OMIM: 603667

KEGG: hsa:8604

STRING: 9606.ENSP00000388658

UniGene: Hs.470608

Involvement In Disease
Epileptic encephalopathy, early infantile, 39 (EIEE39)
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed predominantly in the heart and skeletal muscle, weakly in brain and kidney.

Q&A

What is the molecular structure of Calcium-binding mitochondrial carrier protein Aralar1?

Aralar1 is an integral membrane protein located in the inner mitochondrial membrane, encoded by the SLC25A12 gene on chromosome 2q31.1. The gene spans 110,902 base pairs and produces a 74.8 kDa protein composed of 678 amino acids . The protein has a distinctive structure with two functional domains:

  • N-terminal domain: Contains 2 imperfect EF-hand domains and 3 canonical EF-hand calcium-binding domains that bind calcium in vitro

  • C-terminal domain: Contains the mitochondrial carrier regions responsible for transport function

The protein's dual functionality - calcium sensing and metabolite transport - makes it uniquely suited for integrating calcium signaling with metabolic regulation.

What is the primary function of Aralar1 in cellular metabolism?

Aralar1 functions as a mitochondrial electrogenic aspartate/glutamate antiporter that facilitates the exchange of aspartate generated in the mitochondrial matrix for cytosolic glutamate and a proton . This transport activity is a crucial component of the malate-aspartate shuttle (MAS), which represents the main cellular pathway for transferring reducing equivalents of cytosolic NADH into mitochondria .

The transport function is essential for:

  • Maintaining oxidative glucose consumption

  • Supporting gluconeogenesis from lactate in liver

  • Enabling mitochondrial synthesis and export of aspartate to the cytosol

  • Supporting critical cellular processes including protein synthesis, and pyrimidine and purine nucleotide production

How does Aralar1 differ from its paralog Citrin (SLC25A13)?

While both Aralar1 (SLC25A12/AGC1) and Citrin (SLC25A13/AGC2) are aspartate-glutamate carriers with similar transport mechanisms, they differ in several significant aspects:

PropertyAralar1 (SLC25A12)Citrin (SLC25A13)
Tissue distributionBrain, skeletal muscle, kidney, heartLiver, kidney, heart, small intestine
Sequence identityReference78% identity with Aralar1
Calcium regulationPresentPresent but with slightly different properties
Associated disordersEarly infantile epileptic encephalopathy 39, autism spectrum disordersCITRIN deficiency (NICCD, FTTDCD, CTLN2)
Functional replacementCan functionally replace CitrinCannot adequately replace Aralar1 in neurons

Despite their similarities, these two carriers have evolved distinct physiological roles, with Aralar1 being critical for neural function and Citrin essential for liver metabolism .

What are the recommended methods for detecting Aralar1 protein expression?

For reliable detection of Aralar1 in research contexts, several techniques have been validated:

Western Blotting:

  • Recommended antibody dilution: 1/500 for anti-SLC25A12 antibody

  • Expected molecular weight: 74 kDa

  • Validated sample types: Human cell lines (e.g., HEK-293), rat tissues (heart, kidney), and mouse tissues (kidney, heart)

  • Secondary antibody: Goat polyclonal to rabbit IgG at 1/50000 dilution

Immunohistochemistry:

  • Recommended antibody dilution: 1/100 for paraffin-embedded tissues

  • Validated tissues: Human brain and pancreatic cancer tissue

  • Detection method: Standard DAB (3,3-diaminobenzidine) visualization

Immunofluorescence:

  • Co-staining with mitochondrial markers (e.g., citrate synthase, 1/500) is recommended

  • For dual detection, polyclonal antibody against Aralar (1/500) can be combined with monoclonal antibodies against organelle markers

  • DAPI (1 μg/ml) can be used to visualize nuclei

How can researchers measure Aralar1 transport activity in experimental systems?

Measuring the functional activity of Aralar1 requires specialized assays that assess either direct transport or the broader MAS activity:

Malate-Aspartate Shuttle (MAS) Activity Assay:

  • Isolate mitochondria from experimental tissue (e.g., liver from 6-7 week-old mice)

  • Prepare assay medium containing (in mM): 225 mannitol, 75 sucrose, 10 KCl, 10 Tris-HCl, 5 KH₂PO₄, 0.5 EDTA, and 0.5 EGTA, pH 7.4

  • Add mitochondria (0.1-0.25 mg protein/ml), 0.1 mM NADH, 2.5 mM malate, 2 U/ml malate dehydrogenase, 2 U/ml aspartate aminotransferase

  • Add calcium when indicated (e.g., 200μM CaCl₂)

  • Trigger the reaction with 10 mM glutamate addition

  • Measure activity as the NADH decay rate, corrected for glutamate-independent NADH decay

  • Normalize to protein content using Bradford method

The expected MAS activity in liver mitochondria expressing Aralar1 is approximately 4-6 nmoles × mg protein⁻¹ × min⁻¹ .

What approaches can researchers use to measure cellular redox status when studying Aralar1 function?

Since Aralar1 is integral to the MAS, which affects cellular redox balance, measuring NADH/NAD⁺ ratios is critical:

Single-cell NADH/NAD⁺ Ratio Measurement:

  • Transfect cells with plasmids coding for nuclear ratiometric Peredox-mCherry

  • For experimental manipulation of Aralar1 levels, co-transfect with pcDNA3.1-Aralar-Flag

  • Use cells 24-36 hours post-transfection

  • Preincubate cells in imaging medium (100 mM HEPES, 121 mM NaCl, 4.7 mM KCl, 1.2 mM KH₂PO₄, 1.2 mM MgSO₄, 1.2 mM CaCl₂) supplemented with 2.5-5 mM glucose for 15 minutes

  • Perform measurements at 37°C using an inverted microscope with appropriate filters

  • Confirm co-transfection by immunocytochemistry in fixed cells at the end of the assay

Notably, research has shown that exogenous Aralar1 expression can reverse the increased NADH/NAD⁺ ratio observed in citrin-deficient cells, demonstrating functional complementation .

What genetic models are available for studying Aralar1 function?

Researchers have developed several genetic approaches to study Aralar1 function:

Transgenic Mouse Models:

  • Liver-specific Aralar1 expression: Using the EAlbAAT promoter-intron-aralar-polyadenylation sequence

  • Verification method: PCR using primers from β-globin intron and mouse Aralar sequences

  • Breeding strategy: Crossing founders with desired genetic background (e.g., citrin-deficient mice)

Cell-based Models:

  • Transfection-based overexpression using plasmids like pcDNA3.1-Aralar-Flag

  • CRISPR/Cas9 gene editing for knockout or specific mutations

  • Verification methods include Western blotting and immunocytochemistry

These models allow for both in vivo and in vitro investigation of Aralar1 functions in different physiological contexts.

How can researchers quantify absolute levels of Aralar1 in tissue samples?

Accurate quantification of Aralar1 is essential for comparative studies across tissues or species:

Absolute Quantification Proteomics Approach:

  • Method: Liquid chromatography-mass spectrometry (LC-MS) with parallel reaction monitoring (PRM)

  • Standard: AQUA (Absolute Quantification) peptides

  • Results: This approach revealed that mouse liver has relatively high endogenous Aralar levels (citrin/aralar molar ratio of 7.8), whereas human liver is virtually devoid of Aralar (CITRIN/ARALAR ratio of 397)

This significant difference in endogenous Aralar levels explains why citrin-deficient mice fail to recapitulate human CITRIN deficiency disease, as they maintain substantial MAS activity through residual Aralar1 .

How are mutations in SLC25A12 linked to neurological disorders?

Mutations in the SLC25A12 gene have significant clinical implications:

Early Infantile Epileptic Encephalopathy 39 (EIEE39):

  • Characterized by global hypomyelination of the central nervous system

  • Features refractory seizures and neurodevelopmental impairment

  • Caused by loss-of-function mutations in SLC25A12

Autism Spectrum Disorders:

  • SLC25A12 has established connections to autism

  • Research suggests alterations in mitochondrial aspartate export may affect brain development and function

Understanding these disease associations helps direct therapeutic research toward addressing the specific metabolic deficits caused by Aralar1 dysfunction.

Can Aralar1 functionally replace Citrin in therapeutic applications?

Research on the potential for Aralar1 to substitute for Citrin deficiency shows promising results:

Functional Replacement Evidence:

  • Exogenous Aralar1 expression in citrin-deficient hepatocytes reverses the increased NADH/NAD⁺ ratio

  • Liver mitochondria from citrin-deficient mice expressing transgenic Aralar1 show increased MAS activity (~4-6 nmoles × mg protein⁻¹ × min⁻¹)

  • Aralar1 shares 78% identity with Citrin and has similar transport properties, making it a potentially viable replacement

Therapeutic Advantages:

  • Using Aralar1 for gene therapy may reduce immune response risks compared to using Citrin

  • Aralar1 is expressed in many cell types, including liver Kupffer cells, reducing the likelihood of immune reactivity

This research supports the potential development of Aralar1-based gene therapy approaches for CITRIN deficiency, which includes clinical phenotypes such as neonatal intrahepatic cholestasis (NICCD), failure to thrive and dyslipidemia (FTTDCD), and citrullinemia type II (CTLN2) .

What are the technical challenges in producing functional recombinant Aralar1?

Production of functional recombinant Aralar1 presents several technical challenges:

Expression System Selection:

  • Mammalian expression systems are preferred for proper folding and post-translational modifications

  • Commonly used vectors include pcDNA3.1 with epitope tags (e.g., Flag) for detection

Functional Verification:

  • Western blot confirmation using specific antibodies

  • Immunofluorescence to verify mitochondrial localization

  • Transport assays to confirm functionality

  • NADH/NAD⁺ ratio measurement to verify physiological effect

Common Pitfalls:

  • Improper folding leading to non-functional protein

  • Interference of tags with calcium-binding domains

  • Insufficient mitochondrial targeting

  • Potential toxicity from overexpression

How does calcium regulation affect Aralar1 function and how can this be studied?

Calcium regulation is a distinctive feature of Aralar1 function:

Calcium Dependency:

  • Aralar1's transport function is dependent on the binding of calcium ions to its N-terminal EF-hand domains

  • This calcium sensitivity couples metabolic transport to calcium signaling pathways

Study Approaches:

  • Transport assays with varying calcium concentrations

  • Site-directed mutagenesis of calcium-binding domains

  • Calcium imaging combined with transport measurements

  • Comparison of transport activity in calcium-free (EGTA-containing) versus calcium-supplemented conditions

Understanding this calcium regulation is critical for developing comprehensive models of how Aralar1 integrates signaling and metabolism in different physiological contexts.

What are the most promising research directions for Aralar1 studies?

Several key areas represent promising directions for future Aralar1 research:

Therapeutic Development:

  • Gene therapy approaches using Aralar1 to treat CITRIN deficiency

  • Small molecule modulators of Aralar1 function for neurological disorders

Structural Biology:

  • Detailed structural analyses of calcium-binding domains and their interaction with the transport domain

  • Structure-based drug design targeting Aralar1

Systems Biology:

  • Integration of Aralar1 function into broader metabolic network models

  • Understanding tissue-specific roles in different metabolic states

Clinical Translation:

  • Biomarker development for Aralar1-related disorders

  • Personalized medicine approaches based on patient-specific SLC25A12 variants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.