Recombinant Human Calcium-binding mitochondrial carrier protein Aralar2 (SLC25A13)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Human Calcium-binding mitochondrial carrier protein Aralar2 (SLC25A13) is a laboratory-engineered form of the naturally occurring mitochondrial aspartate/glutamate carrier. It belongs to the solute carrier family 25 (SLC25) and plays critical roles in calcium-regulated metabolite transport across the mitochondrial inner membrane . The recombinant protein is widely used in biochemical assays, diagnostic tools, and mechanistic studies of metabolic disorders .

ParameterDetails
Gene NameSLC25A13
Protein AliasesCitrin, ARALAR2, Mitochondrial aspartate glutamate carrier 2 (AGC2)
Host SystemsE. coli, Yeast, Baculovirus, Mammalian Cells
Purity≥85%–95% (SDS-PAGE verified)
ApplicationsELISA, Western Blot, Immunohistochemistry, Functional Assays
Molecular Weight~74 kDa (full-length isoform 1)

Primary Transport Mechanism

SLC25A13 catalyzes the electrogenic exchange of:

  • Export: 1 aspartate⁴⁻

  • Import: 1 glutamate⁻ + 1 H⁺
    This process is strictly dependent on extramitochondrial calcium levels .

Biological Pathways

  • Malate-Aspartate Shuttle: Transfers reducing equivalents (NADH) into mitochondria for oxidative phosphorylation .

  • Urea Cycle: Supplies aspartate for argininosuccinate synthesis .

  • Gluconeogenesis: Supports glucose synthesis in hepatocytes .

Associated Genetic Disorders

Mutations in SLC25A13 cause:

DisorderClinical FeaturesOnset
Neonatal Intrahepatic Cholestasis (NICCD)Cholestasis, hypoproteinemia, growth retardationNeonatal
Adult-Onset Citrullinemia Type II (CTLN2)Hyperammonemia, neuropsychiatric symptoms (seizures, coma), liver dysfunction20–50 years

Over 60 mutations have been identified, including frameshifts (e.g., c.851del4) and missense variants (e.g., p.S225P) .

Recombinant Protein Variants

Data compiled from MyBioSource and Creative BioMart :

Host SystemPurityApplicationsTarget Species
E. coli>95%Antibody production, enzymatic assaysHuman, Mouse
Mammalian Cells≥85%Structural studies, functional assaysMacaque
Baculovirus≥85%High-yield expressionChicken

Antibody Tools

  • 10789-1-AP (Proteintech): Rabbit polyclonal antibody validated for WB, IHC, and IF .

  • MyBioSource Conjugated Antibodies: Compatible with flow cytometry and in vivo imaging .

Research Findings

  • Calcium Regulation: Structural studies confirm that calcium binding to the N-terminal domain increases transport activity by 5–10 fold .

  • Disease Models: Knockout mice exhibit hepatic steatosis and hyperammonemia, replicating human NICCD/CTLN2 phenotypes .

  • Therapeutic Insights: Dietary interventions (low-carbohydrate, high-protein) mitigate symptoms in citrin-deficient patients .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. To prioritize a particular tag, please specify it in your order.
Synonyms
SLC25A13; ARALAR2; Calcium-binding mitochondrial carrier protein Aralar2; Citrin; Mitochondrial aspartate glutamate carrier 2; Solute carrier family 25 member 13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-675
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SLC25A13
Target Protein Sequence
MAAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVEL LSGVVDQTKDGLISFQEFVAFESVLCAPDALFMVAFQLFDKAGKGEVTFEDVKQVFGQTT IHQHIPFNWDSEFVQLHFGKERKRHLTYAEFTQFLLEIQLEHAKQAFVQRDNARTGRVTA IDFRDIMVTIRPHVLTPFVEECLVAAAGGTTSHQVSFSYFNGFNSLLNNMELIRKIYSTL AGTRKDVEVTKEEFVLAAQKFGQVTPMEVDILFQLADLYEPRGRMTLADIERIAPLEEGT LPFNLAEAQRQKASGDSARPVLLQVAESAYRFGLGSVAGAVGATAVYPIDLVKTRMQNQR STGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKFM HKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGFF GIYKGAKACFLRDIPFSAIYFPCYAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVTP ADVIKTRLQVAARAGQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTLLTY ELLQRWFYIDFGGVKPMGSEPVPKSRINLPAPNPDHVGGYKLAVATFAGIENKFGLYLPL FKPSVSTSKAIGGGP
Uniprot No.

Target Background

Function
Aralar2 (SLC25A13) is a mitochondrial and calcium-binding carrier protein that catalyzes the calcium-dependent exchange of cytoplasmic glutamate and mitochondrial aspartate across the inner mitochondrial membrane. It may also play a role in the urea cycle.
Gene References Into Functions
  1. Correlation between SLC25A13 gene mutations and GGT levels in infants with citrin deficiency-associated neonatal intrahepatic cholestasis (PMID: 28516797)
  2. SLC25A13 gene mutations identified in all neonates with citrin deficiency-associated neonatal intrahepatic cholestasis (NICCD) (PMID: 29419856)
  3. Enrichment of the SLC25A13 mutation spectrum and insights into geographic distribution and genotypes for NICCD diagnosis and molecular target identification (PMID: 27405544)
  4. Association of GLUD1 and SLC25A13 upregulation with tumor aggressiveness and poor prognosis in colorectal cancer (PMID: 27924922)
  5. Identification of SLC25A13 mutations in five patients diagnosed with NICCD (PMID: 28981931)
  6. Review of AGC1 structure, function, calcium regulation, and mitochondrial membrane potential dependence (PMID: 27132995)
  7. Clinical and molecular investigation of an infant with NICCD harboring compound heterozygous SLC25A13 mutations (PMID: 27779681)
  8. Enrichment of the SLC25A13 mutation spectrum through identification of a large deletion (PMID: 27127784)
  9. Identification of compound heterozygous SLC25A13 mutations (c.851_854delGTAT and IVS16ins3kb) in a patient with NICCD (PMID: 27577219)
  10. Structural elucidation of calcium regulation through the N- and C-terminal domains of SLC25A13 (PMID: 25410934)
  11. Screening of five prevalent SLC25A13 mutations in Guangdong to calculate mutation carrier rates (PMID: 25110155)
  12. Review of SLC25A13 gene mutations and genotype-phenotype correlations in citrin deficiency (PMID: 24508627)
  13. Confirmation of NICCD diagnosis through identification of novel compound heterozygous SLC25A13 mutations (PMID: 25365849)
  14. Association of ASS1, ASL, and SLC25A13 point mutations with citrullinemia (PMID: 24927999)
  15. Identification of novel SLC25A13 gene mutations in East Asian patients with citrin deficiency (PMID: 24069319)
  16. Analysis of the SLC25A13 gene sequence (PMID: 23053473)
  17. Frequency of SLC25A13 mutations and prevalence estimation of citrin deficiency in the Thai population (PMID: 24282362)
  18. Regional differences in SLC25A13 mutation spectra in China, impacting diagnostic strategies (PMID: 23901231)
  19. First reported cases of NICCD in infants of Caucasian and Pakistani origin in the UK (PMID: 19517266)
  20. Comparative analysis of human SLC25A* genes, including functional information (PMID: 23266187)
  21. Study on NICCD prevalence, SLC25A13 mutation spectrum, and clinical/biochemical comparisons between NICCD and non-NICCD infants in Thailand (PMID: 23067347)
  22. Marked transcript diversity of the SLC25A13 gene in human PBLs and its implications for molecular diagnosis (PMID: 23022256)
  23. Association of SLC25A13 mutations with citrin deficiency (PMID: 22277121)
  24. Detection of seven NICCD patients through high-resolution melting analysis in 171 suspected patients (PMID: 22487826)
  25. Demonstration of reduced transport activity of SLC25A13 in citrin deficiency through functional studies (PMID: 21914561)
  26. Case report suggesting arginine and sodium pyruvate supplementation as an effective therapy for citrin deficiency (PMID: 18958581)
  27. Higher likelihood of SLC25A13 gene mutations in individuals with non-viral HCC compared to healthy subjects (PMID: 21470889)
  28. Expansion of the genotypic and phenotypic spectrum of citrin deficiency (PMID: 21424115)
  29. Important role of SLC25A13 gene mutations in Chinese infants with intrahepatic cholestasis and aminoacidemia; 851del4 and 1638ins23 as common mutations (PMID: 20927635)
  30. Identification of seven genetic variations of SLC25A13 (PMID: 21507300)
  31. SLC25A13 mutations may not be a major contributor to hepatocellular carcinoma pathogenesis in Taiwan (PMID: 21134364)
  32. Evidence of interaction between ASS1 and SLC25A13 genes on the risk of cleft lip/palate (CL/P) (PMID: 20739017)
  33. Detection of 851del4 SLC25A13 mutations in 400 infants with unexplained intrahepatic cholestasis (PMID: 20458766)
  34. Report of three unrelated Malay children with NICCD caused by the IVS16ins3kb insertion mutation in the SLC25A13 gene (PMID: 20614727)
  35. Presence of SLC25A13 gene mutations in Chinese infants with intrahepatic cholestasis and abnormal amino acids (PMID: 18578996)
  36. Review of citrin and citrin deficiency, food preferences/aversions in citrin-deficient subjects, and carbohydrate toxicity in ureogenesis (PMID: 20233664)
  37. Identification of 851del4, 1638ins23, and IVS6+5G>A as hotspot mutations in Chinese patients with NICCD (PMID: 20376801)
  38. Genetic screening of mutations in early and late-onset citrin deficiency patients in the Japanese population (PMID: 11793471)
  39. Association of adult-onset type II citrullinemia with mutations in the SLC25A13 gene (PMID: 12111366)
  40. Adult-onset citrullinemia (type II, CTLN2) attributed to citrin deficiency caused by SLC25A13 gene mutations (PMID: 17000460)
  41. Utility of citrin protein analysis in peripheral blood lymphocytes for diagnosing citrin deficiency (PMID: 17092749)
  42. Clinical characteristics, biochemical findings, and SLC25A13 gene analysis in Korean patients with citrin deficiency (PMID: 17982687)
  43. Report of 13 novel SLC25A13 mutations in patients with citrin deficiency from various countries (PMID: 18392553)
  44. Possible association of citrin deficiency, caused by SLC25A13 gene mutations, with non-alcoholic fatty liver disease (PMID: 18620775)
  45. Identification of 5 novel SLC25A13 mutations in three unrelated French-Canadian citrin deficiency patients (PMID: 19036621)
  46. Sustained hypercitrullinemia, hypercholesterolemia, and oxidative stress in children with citrin deficiency even during silent periods (PMID: 19232506)
  47. 851del4/1638ins23 mutations in a Chinese adult-onset type II citrullinaemia patient (PMID: 11432966)
Database Links

HGNC: 10983

OMIM: 603471

KEGG: hsa:10165

STRING: 9606.ENSP00000400101

UniGene: Hs.489190

Involvement In Disease
Citrullinemia 2 (CTLN2); Cholestasis, neonatal intrahepatic, caused by citrin deficiency (NICCD)
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
High levels in liver and low levels in kidney, pancreas, placenta, heart and brain.

Q&A

What is the basic function of SLC25A13 in cellular metabolism?

SLC25A13 encodes citrin (also known as Aralar2), which functions as the liver-type mitochondrial aspartate-glutamate carrier isoform 2 (AGC2). This protein is a critical component of the malate-aspartate shuttle (MAS), which represents the primary cellular pathway for transferring redox equivalents of NADH into mitochondria . This function is essential for maintaining oxidative glucose consumption and gluconeogenesis from lactate in liver tissues. Additionally, the MAS allows for mitochondrial synthesis and export of aspartate to the cytosol, which is crucial for protein synthesis, pyrimidine and purine production, and serves as a substrate for the urea cycle in hepatocytes .

How does SLC25A13 differ structurally and functionally from SLC25A12 (Aralar1)?

SLC25A13 (citrin/Aralar2) shares approximately 78% sequence identity with SLC25A12 (Aralar1/AGC1) . While both proteins function as aspartate-glutamate carriers with similar transport properties, they exhibit different tissue distribution patterns and subtle differences in calcium regulation mechanisms . Aralar1 is predominantly expressed in the brain and other tissues, whereas citrin is primarily expressed in the liver, kidney, and heart. The proteins have slightly different calcium regulation properties, which may contribute to their tissue-specific functions . Notably, the presence of aralar in liver Kupffer cells suggests potential therapeutic applications where aralar might substitute for citrin without triggering immune responses .

What are the known post-translational modifications of SLC25A13 that affect its function?

SLC25A13 undergoes calcium-dependent regulation through EF-hand calcium-binding domains located in its N-terminal region. These domains allow the protein to respond to changes in calcium concentrations, affecting its transport function . In experimental settings, the addition of 200 nM Ruthenium Red (RR) is used to inhibit calcium uptake into mitochondria during MAS activity assays, indicating the importance of calcium regulation for proper protein function . Research indicates that these calcium-binding domains play a critical role in modulating transport activity in response to cellular signaling events.

What are the most reliable methods for quantifying SLC25A13 protein expression in experimental samples?

Several approaches have been validated for SLC25A13 quantification:

  • ELISA-based detection: Sandwich ELISA kits are available with detection ranges of 0.312-20 ng/mL and sensitivities of approximately 0.12 ng/mL for human samples. These kits demonstrate high specificity with intra-assay CV of 4.5% and inter-assay CV of 8.3% .

  • Absolute quantification proteomics: This approach has been used to determine the relative levels of citrin and aralar in mouse and human liver samples. Studies have revealed significant species differences, with mouse liver having a citrin/aralar molar ratio of 7.8, while human liver is nearly devoid of aralar (CITRIN/ARALAR ratio of 397) .

  • Immunoblotting: Western blot analysis using polyclonal antibodies against aralar (typically at 1/500 dilution) or monoclonal antibodies against citrin provides semi-quantitative assessment of protein levels .

  • Immunofluorescence microscopy: Visualization of protein localization using antibodies against aralar (1/500 dilution) combined with mitochondrial markers such as citrate synthase (1/500 dilution) enables assessment of subcellular distribution .

How can SLC25A13 mutations be effectively identified and characterized in research settings?

Multiple complementary approaches can be employed for thorough mutation analysis:

  • Direct DNA sequencing: The primary method for identifying known and novel mutations in the SLC25A13 gene .

  • cDNA cloning analysis: This approach using peripheral blood lymphocytes (PBLs) has been established as a less invasive tool to identify aberrant SLC25A13 transcripts. The procedure involves PCR amplification using primer pairs that cover the entire coding region, followed by cloning and sequence analysis .

  • PCR-RFLP (Restriction Fragment Length Polymorphism): Useful for screening specific known mutations in larger populations .

  • In silico prediction tools: Software like PolyPhen-2 can be used to predict the functional effect of novel missense mutations, with scores above 0.85 classified as "probably damaging" and scores above 0.15 as "possibly damaging" .

  • Alternative splicing variant (ASV) analysis: Identification of ASVs through cDNA cloning provides insights into pathogenic mechanisms of certain mutations .

What is the optimal experimental design for measuring malate-aspartate shuttle (MAS) activity in relation to SLC25A13 function?

The reconstitution and measurement of MAS activity requires precise experimental conditions:

  • Sample preparation: Isolation of mitochondria (0.1-0.15 mg) from liver tissue using standardized protocols and resuspension in appropriate buffer (MSK buffer) .

  • Reconstitution components:

    • 4 U/ml aspartate aminotransferase (GOT)

    • 6 U/ml malate dehydrogenase (MDH)

    • 66 μM NADH

    • 5 mM aspartate

    • 5 mM malate

    • 0.5 mM ADP

    • 200 nM Ruthenium Red (RR)

  • Enzyme purification: To remove contaminant α-ketoglutarate from GOT, the enzyme should be dialyzed in 3 M (NH₄)₂SO₄ + 1 mM pyridoxal phosphate for 48 hours at 4°C with shaking (1:100 volume ratio) .

  • Calcium calibration: Free calcium concentrations should be calibrated using fluorescent indicators such as Fura-2 and Calcium Green .

  • Control considerations: Appropriate controls including mitochondria from wildtype and knockout models should be included to validate MAS activity measurements.

How do mutations in SLC25A13 lead to the spectrum of citrin deficiency disorders?

Citrin deficiency (CD) manifests as four distinct clinical phenotypes across the lifespan:

  • Neonatal Intrahepatic Cholestasis caused by Citrin Deficiency (NICCD): Affects newborns and infants, presenting with jaundice, hypoproteinemia, hypoglycemia, and elevated citrulline levels .

  • Silent period: Following NICCD, many patients enter a period without obvious symptoms .

  • Failure to Thrive and Dyslipidemia caused by Citrin Deficiency (FTTDCD): Occurs in some post-NICCD children .

  • Citrullinemia Type II (CTLN2): Adult-onset manifestation characterized by hyperammonemia, neuropsychiatric symptoms, and elevated plasma citrulline .

The pathophysiological mechanisms link to disruption of the malate-aspartate shuttle due to citrin deficiency, which leads to:

  • Impaired transfer of NADH reducing equivalents into mitochondria

  • Cytosolic redox imbalance (increased NADH/NAD⁺ ratio)

  • Impaired aspartate export from mitochondria to cytosol

  • Defects in urea cycle function, particularly affecting argininosuccinate synthetase

What evidence supports the potential of aralar (SLC25A12) as a therapeutic replacement for citrin in SLC25A13 deficiency?

Several lines of evidence support aralar's therapeutic potential:

  • Functional replacement in mouse models: Studies in citrin(-/-) mice demonstrate that exogenous aralar expression reverses the increased NADH/NAD⁺ ratio observed in hepatocytes lacking citrin .

  • Mitochondrial MAS activity restoration: Liver mitochondria from citrin(-/-) mice expressing liver-specific transgenic aralar show consistent increases in MAS activity (approximately 4-6 nmoles × mg protein⁻¹ × min⁻¹) compared to citrin(-/-) mice without aralar expression .

  • Structural and functional similarity: Aralar shares 78% identity with citrin and has similar transport properties, suggesting functional compatibility .

  • Reduced immunogenicity risk: Since aralar is expressed in many cell types, particularly in liver Kupffer cells, it is unlikely that aralar-based gene therapy would trigger an immune response .

  • Species-specific considerations: Important differences exist between mouse and human liver regarding endogenous aralar levels, with human liver being virtually devoid of aralar (CITRIN/ARALAR ratio of 397 in humans vs. 7.8 in mice). This suggests that increasing aralar expression in human liver could effectively improve redox balance capacity .

How do geographic and genetic factors influence the mutation spectrum of SLC25A13?

Geographic distribution analysis of SLC25A13 mutations reveals significant patterns:

  • North-South variations in China: A large NICCD cohort study of 116 Chinese cases demonstrated that four high-frequency mutations contributed a significantly larger proportion of mutated alleles in patients from south China compared to those from north China (χ² = 14.93, P<0.01), with 30°N latitude serving as the geographic dividing line .

  • Mutation diversity: At least 81 different pathogenic mutations have been identified worldwide, including missense, nonsense, splice-site, deletion, and insertion variants .

  • Novel mutations: Recent studies have identified 16 novel pathogenic mutations in patients from China, Japan, and Malaysia, including:

    • 9 missense mutations

    • 4 nonsense mutations

    • 1 splice-site mutation

    • 1 deletion

    • 1 large transposal insertion (IVS4ins6kb)

  • Diagnosis rates: DNA diagnostic methods have shown that more than 90% of patients diagnosed with CTLN2 by enzymatic analysis carry SLC25A13 mutations in both alleles .

What experimental approaches are recommended for studying the interaction between SLC25A13 and calcium signaling pathways?

To investigate the calcium-dependent regulation of SLC25A13:

  • Calcium binding assays: Use purified recombinant N-terminal domains of SLC25A13 containing the EF-hand motifs to measure calcium binding affinity using isothermal titration calorimetry or fluorescence-based assays.

  • Live-cell calcium imaging: Combine fluorescent calcium indicators with tagged SLC25A13 to monitor real-time changes in transport activity in response to calcium fluctuations.

  • Site-directed mutagenesis: Introduce mutations in the calcium-binding domains to assess their impact on protein function and regulation. Studies should include both loss-of-function and gain-of-function mutations.

  • Reconstitution in liposomes: Incorporate purified SLC25A13 into liposomes with controlled calcium concentrations to directly measure transport activity.

  • Calcium chelation effects: Use experimental designs that include calcium chelators (EGTA/BAPTA) and calcium ionophores to manipulate calcium levels while monitoring SLC25A13 activity.

How can transgenic mouse models be optimized for studying SLC25A13 function and related diseases?

Based on current research approaches, optimized transgenic models should incorporate:

  • Liver-specific expression systems: Use liver-specific promoters like EAlbAAT for targeted expression, as demonstrated in the generation of liver-specific aralar transgenic mice (LAralar Tg) .

  • Prevention of silencing: Include β-globin intron between the promoter and the target cDNA to decrease the possibility of silencing, as implemented in pCMV5-AlbEnh-βglobin-mAralar (pLAralar) constructs .

  • Tissue-specific knockout strategies: Generate conditional knockout models using Cre-lox systems to study the tissue-specific effects of SLC25A13 deficiency.

  • Humanized mouse models: Consider species differences in endogenous aralar levels when designing models. The significantly higher CITRIN/ARALAR ratio in human liver (397) compared to mouse liver (7.8) suggests that humanized models may better recapitulate human disease conditions .

  • Marker incorporation: Include appropriate epitope tags (such as Flag) to facilitate detection and differentiation from endogenous proteins .

What analytical considerations are important when interpreting proteomic data related to SLC25A13 expression?

When analyzing proteomic data for SLC25A13:

  • Absolute quantification approach: Use targeted proteomics with isotope-labeled internal standards to determine absolute protein quantities, as relative quantification may be misleading when comparing across tissues or species .

  • Species differences: Account for the substantial variation in citrin/aralar ratios between species (7.8 in mouse liver vs. 397 in human liver), which impacts the interpretation of animal model findings .

  • Tissue heterogeneity: Consider that SLC25A13 expression varies across cell types within tissues. For instance, aralar is expressed in liver Kupffer cells but not significantly in hepatocytes .

  • Subcellular fractionation quality: Ensure high-quality mitochondrial isolation to accurately assess mitochondrial carrier proteins, as contamination from other cellular compartments can skew results.

  • Post-translational modifications: Implement proteomic approaches that can detect relevant post-translational modifications, particularly those affecting the calcium-binding domains that regulate transport activity.

What are the most common technical challenges in SLC25A13 cDNA cloning, and how can they be addressed?

Common challenges and solutions include:

  • Low expression levels: Optimize RNA extraction using specialized kits for low-abundance transcripts. Consider using peripheral blood lymphocytes (PBLs) as a less invasive source of material compared to liver biopsies .

  • PCR amplification difficulties: Design nested PCR approaches with high-fidelity polymerases. For SLC25A13, effective primer combinations include:

    • First PCR: Ex-4F (5'-AACGCACGCTGCCTGGCCGTATC-3') and RACEA1 (5'-CCACCTTCACAAATTCATGCGCC-3')

    • Second PCR: RAS3 (5'-GCCGCCGGGACTAGAAGTGAGC-3') and Ex18R (5'-TGCTTCATTCCCAGGAGGGA-3')

  • Clone screening efficiency: Implement "white-blue spot selection" for initial screening of positive clones, followed by PCR confirmation using appropriate primers .

  • Alternative splicing detection: When analyzing cDNA clones, be vigilant for alternative splicing variants (ASVs) which may be relevant to disease mechanisms. Compare the proportion of ASVs between patients and healthy controls using statistical methods like chi-square tests .

  • Reference sequence alignment: Ensure proper alignment with current reference sequences, as SLC25A13 nomenclature and reference sequences have evolved over time.

What quality control parameters should be monitored when using recombinant SLC25A13 in functional assays?

Key quality control parameters include:

  • Protein purity: Verify >95% purity by SDS-PAGE and mass spectrometry before functional studies.

  • Folding integrity: Assess proper folding using circular dichroism spectroscopy, focusing on secondary structure elements characteristic of mitochondrial carrier proteins.

  • Mitochondrial targeting sequence status: Confirm whether the recombinant protein includes or excludes the mitochondrial targeting sequence, as this affects localization and function.

  • Post-translational modifications: Verify the presence of essential modifications, particularly in calcium-binding domains.

  • Functional validation: Prior to complex experiments, validate basic transport function using reconstituted liposome systems with defined substrate concentrations.

  • Batch consistency: Implement lot-to-lot validation to ensure consistent protein quality across experimental timeframes.

How can researchers distinguish between primary effects of SLC25A13 deficiency and secondary metabolic adaptations in experimental models?

To differentiate primary from secondary effects:

  • Time-course studies: Implement temporal analysis beginning immediately after gene deletion or inhibition to capture primary effects before compensatory mechanisms develop.

  • Acute vs. chronic models: Compare acute knockdown (e.g., using siRNA) with stable genetic knockout models to distinguish immediate consequences from adapted states.

  • Metabolic flux analysis: Use isotope-labeled metabolites to track changes in metabolic pathways directly linked to SLC25A13 function, particularly aspartate metabolism and the malate-aspartate shuttle.

  • Tissue-specific conditional models: Employ inducible tissue-specific knockout systems to observe the immediate consequences of SLC25A13 deletion in specific cell types.

  • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics data to build comprehensive models distinguishing primary pathway disruptions from secondary adaptations.

  • Rescue experiments: Perform targeted rescue of specific pathways to determine which phenotypes are directly attributable to SLC25A13 deficiency.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.