Recombinant Human Calcium-binding mitochondrial carrier protein SCaMC-1 (SLC25A24)

Shipped with Ice Packs
In Stock

Description

Protein Structure and Functional Domains

SCaMC-1 comprises three structural domains:

  • N-terminal regulatory domain: Contains calcium-binding EF-hand motifs, enabling Ca²⁺ sensitivity .

  • Linker loop domain: Includes an amphipathic α-helix critical for Ca²⁺-mediated regulation .

  • C-terminal mitochondrial carrier domain: Facilitates ATP-Mg²⁺/ADP-Pi exchange across the inner mitochondrial membrane .

The full-length protein spans 477 amino acids, with a molecular weight of ~53 kDa .

Recombinant Production Systems and Applications

Recombinant SCaMC-1 is produced in diverse systems for structural and functional studies:

Source OrganismTagKey ApplicationsReferences
E. coliHis, AviStructural studies, biotinylation assays
YeastN/AHigh-yield production for biochemical assays
Mammalian cellsN/ANative conformational studies
BaculovirusN/ALarge-scale expression for therapeutic research

Notable Features:

  • His-tagged versions: Enable immobilization for binding assays .

  • Avi-tag biotinylation: Facilitates in vivo biotin labeling for tracking .

  • Partial proteins: Truncated forms (e.g., 1-197 aa) used in antibody validation .

Biological Function

SCaMC-1 mediates Ca²⁺-dependent ATP-Mg²⁺/ADP-Pi transport, modulating mitochondrial calcium retention capacity (CRC) and preventing permeability transition (mPT) :

Mechanistic RoleImpactExperimental Evidence
ATP-Mg²⁺/ADP-Pi exchangeBuffers mitochondrial Ca²⁺ overloadReduced transport in SCaMC-1-KD cells
Ca²⁺-triggered nucleotide uptakeDesensitizes mPT pore openingCRC assays in COS-7 and 143B cells
Regulation via α-helix locking pinModulates carrier activity in response to Ca²⁺Thermostability assays

Pathological Relevance:

  • Cancer survival: Overexpression in tumors enhances Ca²⁺ buffering, conferring resistance to oxidative stress-induced necrosis .

  • Therapeutic target: Knockdown sensitizes cancer cells to mPT-mediated death .

4.1. Calcium Regulation Mechanism

SCaMC-1’s activity is regulated via a locking pin mechanism involving its amphipathic α-helix:

  • Ca²⁺ binding: Triggers conformational changes, enabling substrate transport .

  • Thermostability assays: Confirmed Ca²⁺-dependent structural stabilization .

4.2. Cancer Cell Survival

Experimental ModelInterventionOutcomeReference
COS-7, 143B cellsSCaMC-1 knockdownReduced ATP-Mg²⁺/ADP-Pi transport (55-56% of control)
Liver clone-9 cellsSCaMC-1 overexpressionEnhanced resistance to H₂O₂-induced necrosis

Key Insight: SCaMC-1’s overexpression in cancer cells correlates with elevated mitochondrial Ca²⁺ buffering, enabling evasion of mPT-driven cell death .

Applications in Research and Therapy

  • Antibody validation: Recombinant SCaMC-1 fragments (e.g., 1-75 aa) serve as controls for immunoblotting and immunoprecipitation .

  • Drug discovery: Targeting SCaMC-1 may disrupt calcium buffering in cancer mitochondria, enhancing chemotherapy efficacy .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms are stable for 6 months at -20°C/-80°C, while lyophilized forms are stable for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SLC25A24; APC1; MCSC1; SCAMC1; Calcium-binding mitochondrial carrier protein SCaMC-1; Mitochondrial ATP-Mg/Pi carrier protein 1; Mitochondrial Ca(2+-dependent solute carrier protein 1; Small calcium-binding mitochondrial carrier protein 1; Solute carrier family 25 member 24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-477
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SLC25A24
Target Protein Sequence
MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAE EKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGL TISEQQAELILQSIDVDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTI PDEFTEDEKKSGQWWRQLLAGGIAGAVSRTSTAPLDRLKIMMQVHGSKSDKMNIFGGFRQ MVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGA TAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIPYAGI DLAVYELLKSYWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLE GSPQLNMVGLFRRIISKEGIPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVTQK
Uniprot No.

Target Background

Function
Recombinant Human Calcium-binding mitochondrial carrier protein SCaMC-1 (SLC25A24) is a calcium-dependent mitochondrial solute carrier. It mediates the reversible, electroneutral exchange of Mg-ATP or Mg-ADP for phosphate ions, catalyzing the net uptake or efflux of adenine nucleotides across the mitochondrial inner membrane. Nucleotide transport is inactive at low cytosolic calcium levels and is activated by increased cytosolic calcium. SCaMC-1 may protect cells from oxidative stress-induced cell death, possibly by promoting calcium-phosphate precipitate formation in the mitochondrial matrix, thereby buffering matrix calcium levels.
Gene References Into Functions
Expand References
  1. SLC25A24 mutations induce a gain of pathological function. PMID: 29100093
  2. SLC25A24 mutations impair mitochondrial ATP synthesis. PMID: 29100094
  3. Human and mouse model analyses highlight SLC25A24/Slc25a24's role in regulating body fat mass and adipogenesis. PMID: 25599384
  4. N-terminal EF hands form a self-sequestered, compact calmodulin-like Ca2+-sensor in the presence of Ca2+. PMID: 24332718
  5. SCaMC-1 is the human ortholog of the rabbit Efinal protein, reported to be peroxisomal. PMID: 15054102
  6. Three isoforms of the mitochondrial ATP-Mg/Pi carrier (APC1, APC2, and APC3) have been identified; these likely mediate the net uptake or efflux of adenine nucleotides in mitochondria. PMID: 15123600
Database Links

HGNC: 20662

OMIM: 608744

KEGG: hsa:29957

STRING: 9606.ENSP00000457733

UniGene: Hs.656870

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Present in various cell lines (at protein level). Expressed in all tissues tested. Highly expressed in testis, expressed at intermediate level in small intestine and pancreas, and weakly expressed in kidney, spleen, liver, skeletal muscle and heart.

Q&A

What is the basic structure and domain organization of SCaMC-1/SLC25A24?

SCaMC-1 (SLC25A24) belongs to a subfamily of calcium-binding mitochondrial carriers characterized by a dual-domain architecture. The protein consists of approximately 500 amino acids with a highly conserved mitochondrial carrier domain at the C-terminus responsible for substrate transport, and an N-terminal extension harboring four EF-hand calcium-binding motifs with high similarity to calmodulin . This structural arrangement is characteristic of the SCaMC family, which includes three highly conserved members (SCaMC-1, SCaMC-2, and SCaMC-3) that share 70-80% sequence identity .

The calcium-binding N-terminal extension faces the cytosolic side of the mitochondrial inner membrane, enabling direct regulation by cytosolic calcium without requiring calcium entry into the mitochondria. The C-terminal carrier domain contains the characteristic mitochondrial carrier protein signature sequences and transmembrane regions necessary for substrate transport .

What is the primary function of SCaMC-1 in mitochondrial metabolism?

SCaMC-1 functions as an electro-neutral and reversible exchanger of ATP-Mg2- and phosphate between the cytosol and mitochondria . This transport activity is crucial for maintaining optimal adenine nucleotide levels in the mitochondrial matrix . Upon increases in cytosolic calcium concentration, SCaMC-1 mediates ATP-Mg2-/Pi2- and/or HADP2-/Pi2- uptake into the mitochondria .

Importantly, the transported ATP and ADP contribute to calcium buffering in the mitochondrial matrix, resulting in desensitization of the mitochondrial permeability transition (mPT) . This process establishes SCaMC-1 as a critical regulator that exerts negative feedback control between cellular calcium overload and mPT-dependent cell death mechanisms . The calcium-sensing capability through its N-terminal EF-hand motifs allows SCaMC-1 to transduce calcium signals to mitochondria without requiring calcium entry into the organelle itself .

How does SCaMC-1 differ from other mitochondrial carrier proteins in the SLC25 family?

SCaMC-1 differs from conventional mitochondrial carriers in the SLC25 family primarily through its calcium-binding regulatory domain. While most SLC25 family members consist only of the approximately 300-amino acid carrier domain with six transmembrane segments, SCaMC-1 contains the additional N-terminal extension with four EF-hand calcium-binding motifs .

This structural distinction places SCaMC-1 in a specialized subfamily of calcium-binding mitochondrial carriers (CaMCs), which includes the aspartate/glutamate carriers (AGCs) like Aralar1 and citrin . Unlike other mitochondrial carriers whose activity is regulated by substrate availability or membrane potential, SCaMC-1 activity is directly modulated by cytosolic calcium concentrations through its calcium-binding domain . This unique regulatory mechanism provides a direct link between cytosolic calcium signaling and mitochondrial metabolite transport without requiring calcium influx into mitochondria.

What are the recommended methods for expressing and purifying recombinant SCaMC-1 protein for functional studies?

For expressing and purifying functional recombinant SCaMC-1, researchers should consider the following methodological approach:

Expression System Selection:

  • Mammalian expression systems (HEK293T, COS-7) are preferable for obtaining properly folded SCaMC-1 with post-translational modifications .

  • For higher yields, baculovirus-insect cell systems can be employed while maintaining proper protein folding.

Construct Design Considerations:

  • Include a cleavable tag (His6 or FLAG) for purification

  • Consider expressing the C-terminal carrier domain separately if studying transport function, as the full-length protein with N-terminal extension may have reduced mitochondrial import efficiency when overexpressed .

  • For structural studies, removal of flexible regions might improve crystallization properties.

Purification Protocol:

  • Cell lysis using mild detergents (0.5-1% DDM or CHAPS) to preserve protein structure

  • Affinity chromatography using the fusion tag

  • Size exclusion chromatography to obtain homogeneous protein

  • Consider calcium-free and calcium-bound states for functional comparisons

Quality Control Checkpoints:

  • Verify proper folding using circular dichroism spectroscopy

  • Confirm calcium binding using isothermal titration calorimetry

  • Test transport activity in reconstituted liposomes

When expressing full-length SCaMC-1 in cellular systems, researchers should be aware that the N-terminal extension can reduce mitochondrial import efficiency, resulting in cytosolic aggregation in some cases . Truncation of the N-terminal domain has been shown to increase mitochondrial targeting by approximately 60% .

What experimental systems are optimal for studying SCaMC-1 function in a cellular context?

Several experimental systems have proven effective for investigating SCaMC-1 function in cellular contexts:

Cellular Models:

  • Cancer cell lines: Given SCaMC-1's overexpression in transformed cells, cancer cell lines provide relevant contexts for studying its role in cell survival. HeLa, HEK293T, and COS-7 cells have been successfully used .

  • Knockdown/knockout approaches: siRNA-mediated knockdown of SCaMC-1 has been shown to reduce mitochondrial calcium buffering capacity and sensitize cells to mPT-mediated necrotic death triggered by oxidative stress . CRISPR-Cas9 knockout systems can provide complete loss-of-function models.

  • Primary cell cultures: For studying tissue-specific functions, primary cells isolated from tissues with high SCaMC-1 expression provide physiologically relevant models.

Analytical Techniques:

  • Calcium imaging: To monitor mitochondrial and cytosolic calcium dynamics

  • Mitochondrial membrane potential measurements: Using fluorescent probes (TMRM, JC-1)

  • Mitochondrial permeability transition assays: Measuring calcium retention capacity

  • Respirometry: Oxygen consumption rate measurements to assess functional impact on mitochondrial bioenergetics

  • Live cell imaging: For tracking protein localization and dynamics using fluorescent fusion proteins

Recommended Stress Models:

  • Oxidative stress induction (H₂O₂ treatment)

  • Calcium overload (ionomycin, thapsigargin)

  • Metabolic stress (glucose deprivation, hypoxia)

For optimal results, researchers should include appropriate controls, including rescue experiments with wild-type protein following knockdown, and parallel studies with other SCaMC family members to identify isoform-specific functions.

What are the challenges in designing experiments to study calcium-dependent regulation of SCaMC-1 transport activity?

Studying calcium-dependent regulation of SCaMC-1 presents several methodological challenges that researchers should address in their experimental design:

Challenge 1: Calcium Concentration Control

  • Precisely controlling calcium concentrations across cellular compartments is difficult

  • Solution: Use permeabilized cell systems where cytosolic calcium can be directly manipulated, or calcium ionophores with calibrated external calcium concentrations

Challenge 2: Temporal Resolution

  • Calcium signaling occurs rapidly, while metabolite transport may have different kinetics

  • Solution: Employ rapid imaging techniques and synchronize calcium measurements with transport assays; consider using caged calcium compounds for precise temporal control

Challenge 3: Distinguishing Direct from Indirect Effects

  • Changes in calcium can affect multiple pathways simultaneously

  • Solution: Use SCaMC-1 mutants with disabled calcium-binding sites (EF-hand mutations) as controls; employ reconstituted systems with purified components

Challenge 4: Measuring Transport Activity

  • Direct measurement of ATP-Mg/Pi transport is technically challenging

  • Solution: Use radioisotope transport assays in isolated mitochondria or proteoliposomes; alternatively, employ indirect indicators such as matrix adenine nucleotide levels

Challenge 5: Physiological Relevance

  • Ensuring experimental conditions reflect physiological calcium fluctuations

  • Solution: Validate findings using calcium-mobilizing physiological stimuli in intact cells; compare effects across multiple cell types with varying endogenous SCaMC-1 levels

A recommended experimental setup would include:

  • Isolated mitochondria with controlled extra-mitochondrial calcium concentrations

  • Parallel measurement of calcium levels and substrate transport rates

  • Comparison between wild-type SCaMC-1 and calcium-binding mutants

  • Validation in intact cellular systems using physiological calcium mobilization

How does SCaMC-1 overexpression contribute to cancer cell survival mechanisms?

SCaMC-1 overexpression has been identified as a general feature of transformed and cancer cells, playing a significant role in their survival mechanisms . The molecular basis for this contribution involves several interconnected pathways:

Desensitization of Mitochondrial Permeability Transition:
SCaMC-1 mediates ATP-Mg²⁻/Pi²⁻ and/or HADP²⁻/Pi²⁻ uptake into mitochondria following cytosolic calcium increases . These adenine nucleotides enhance calcium buffering capacity in the mitochondrial matrix, which directly desensitizes the mitochondrial permeability transition pore (mPTP) . As a result, cancer cells with SCaMC-1 overexpression can withstand higher calcium loads and oxidative stress before undergoing mPT-mediated necrotic cell death.

Negative Feedback Control:
SCaMC-1 establishes a negative feedback mechanism between cellular calcium overload and mPT-dependent cell death . This regulatory circuit allows cancer cells to maintain mitochondrial integrity despite metabolic alterations and increased calcium signaling that would otherwise trigger cell death.

Experimental Evidence:
Knockdown of SCaMC-1 has been shown to significantly reduce mitochondrial calcium buffering capacity and sensitize cancer cells to death triggered by oxidative stress and calcium overload . This demonstrates that SCaMC-1 acts as a protective factor against stress-induced cell death pathways that would normally eliminate transformed cells.

Experimental ConditionMitochondrial Ca²⁺ Buffering CapacitySensitivity to Oxidative StressCell Death Pathway
Normal SCaMC-1 levelsNormalNormalRegulated
SCaMC-1 overexpressionEnhancedReducedResistant
SCaMC-1 knockdownVastly reducedHighly sensitivemPT-mediated necrosis

These findings suggest that targeting SCaMC-1 could represent a novel therapeutic approach for cancer treatment, potentially re-sensitizing resistant cancer cells to stress-induced death pathways .

What is the relationship between SCaMC-1 mutations and Fontaine syndrome?

De novo mutations in the SLC25A24 gene encoding SCaMC-1 have been identified as the genetic cause of Fontaine syndrome, a rare disorder characterized by early aging, congenitally decreased subcutaneous fat tissue, sparse hair, bone dysplasia of the skull and fingers, a distinctive facial appearance, and both prenatal and postnatal growth retardation .

Specific Mutations and Molecular Mechanisms:
The two critical mutations identified in Fontaine syndrome patients are c.649C>T (p.Arg217Cys) and c.650G>A (p.Arg217His) in SLC25A24 . Both mutations affect the same arginine residue (Arg217) in the protein. Molecular dynamic simulation studies predict that these mutations narrow the substrate cavity of the protein and disrupt transporter dynamics .

The Arg217 residue appears to be critical for the proper functioning of the transport mechanism. The mutations likely alter the conformational changes necessary for the carrier to alternate between states, affecting its ability to transport ATP-Mg and phosphate across the mitochondrial inner membrane .

Functional Consequences:
The disruption of optimal adenine nucleotide levels in the mitochondrial matrix due to these mutations likely impacts multiple mitochondrial functions, including:

  • Energy production

  • Calcium homeostasis

  • Cellular stress responses

  • Developmental processes

The manifestation of premature aging phenotypes in affected individuals suggests that proper SCaMC-1 function is essential for normal tissue development and maintenance, particularly in tissues affected in the syndrome (skin, bone, adipose tissue) .

This genetic evidence further emphasizes the critical role of SCaMC-1 in cellular homeostasis beyond its previously established functions in cancer cell survival, pointing to its importance in normal development and aging processes.

What experimental approaches can distinguish the role of SCaMC-1 from other calcium-binding mitochondrial carriers in disease models?

Distinguishing the specific contributions of SCaMC-1 from other calcium-binding mitochondrial carriers (CaMCs) in disease models requires sophisticated experimental approaches that exploit the unique properties of each carrier. The following methodological strategies can be employed:

1. Isoform-Specific Genetic Manipulation:

  • CRISPR-Cas9 targeting of SCaMC-1-specific exons

  • siRNA with validated specificity against SCaMC-1 but not other family members

  • Rescue experiments with SCaMC-1 variants resistant to siRNA but maintaining function

  • Conditional knockout models to avoid developmental compensation

2. Substrate Specificity Analysis:
SCaMC-1 specifically transports ATP-Mg²⁻/Pi²⁻, which distinguishes it from other CaMCs like Aralar1 and citrin that transport aspartate/glutamate . Researchers can:

  • Measure specific transport activities using radioisotope-labeled substrates

  • Employ substrate analogs that selectively inhibit specific transporters

  • Monitor changes in matrix adenine nucleotide content versus amino acid content

3. Domain-Specific Functional Assays:
SCaMC-1 has unique structural features including four EF-hand motifs in its N-terminal extension . Experimental approaches can include:

  • Calcium-binding assays with purified N-terminal domains

  • Creation of chimeric proteins swapping domains between different CaMCs

  • Point mutations in calcium-binding sites to alter calcium sensitivity

4. Disease-Relevant Phenotypic Analysis:

  • For cancer models: Focus on cell death resistance, mitochondrial calcium handling, and response to stress

  • For Fontaine syndrome: Analyze premature aging markers, adipocyte differentiation, and bone development

5. Temporal and Spatial Expression Patterns:
SCaMC family members show distinct tissue distribution patterns. Researchers should:

  • Use tissue-specific promoters for genetic manipulations

  • Consider developmental timing of expression

  • Evaluate subcellular localization, as some variants may show differential distribution

Comparative Experimental Design Matrix:

Experimental ApproachSCaMC-1Aralar1/Citrin (AGCs)Other Mitochondrial Carriers
Substrate preferenceATP-Mg²⁻/Pi²⁻Aspartate/glutamateVarious metabolites
Response to calciumThrough N-terminal EF-handsThrough N-terminal EF-handsCalcium-independent
Disease associationCancer, Fontaine syndromeEpilepsy, citrullinemiaVarious metabolic disorders
Tissue specificityCheck expression databaseBrain, liverTissue-dependent

By employing multiple complementary approaches and always including appropriate controls for other family members, researchers can confidently attribute specific disease phenotypes to SCaMC-1 function.

How do the EF-hand motifs in SCaMC-1 regulate its transport activity in response to calcium signals?

The regulation of SCaMC-1 transport activity by calcium involves complex mechanisms centered on its unique N-terminal extension containing four EF-hand calcium-binding motifs. This regulatory process can be explained through several interconnected molecular events:

Calcium Binding and Conformational Changes:
The N-terminal extension of SCaMC-1 contains four EF-hand motifs with high similarity to calmodulin . Upon binding calcium, these motifs undergo significant conformational changes from a "closed" to an "open" state. This calcium-induced structural rearrangement propagates to the C-terminal carrier domain, altering its conformation and activating the transport function .

The N-terminal extension faces the cytosolic side of the mitochondrial inner membrane, allowing it to directly sense changes in cytosolic calcium concentration without requiring calcium entry into mitochondria . This arrangement provides a mechanism for rapid transduction of calcium signals to mitochondrial metabolite transport.

Structure-Function Relationship:
The four EF-hand motifs likely have different calcium affinities, allowing SCaMC-1 to respond to a range of cytosolic calcium concentrations. Based on studies of similar calcium-binding proteins, the conformational changes involve exposure of hydrophobic surfaces that can interact with the carrier domain to relieve auto-inhibition or promote an active conformation.

Regulatory Model:
In the absence of calcium, the N-terminal extension likely adopts a conformation that restricts the conformational changes needed for the transport cycle of the carrier domain. When calcium binds to the EF-hands, the resulting conformational change removes this inhibition, allowing the carrier domain to cycle between states necessary for ATP-Mg²⁻/Pi²⁻ exchange.

Experimental Evidence:
Truncation of the N-terminal extension containing the EF-hand motifs has been shown to affect the mitochondrial targeting of SCaMC-1, with the truncated protein showing higher mitochondrial localization efficiency . This suggests that the calcium-binding domain may also regulate the mitochondrial import of the protein, adding another layer of calcium-dependent regulation.

Understanding this regulatory mechanism is crucial for developing targeted approaches to modulate SCaMC-1 activity in disease contexts, particularly in cancer where its desensitization of mitochondrial permeability transition contributes to cell survival .

What molecular interactions determine the specificity of SCaMC-1 for ATP-Mg/Pi transport?

The molecular basis for SCaMC-1's specificity for ATP-Mg/Pi transport can be understood through several key structural and functional determinants:

Substrate-Binding Site Architecture:
SCaMC-1 belongs to the mitochondrial carrier family, characterized by a tripartite structure with three homologous domains, each containing two transmembrane helices . The substrate-binding site likely forms at the interface of these domains, creating a central cavity with specific amino acid residues that interact with ATP-Mg and phosphate.

Conserved Substrate-Interacting Residues:
Analysis of SCaMC-1 and its paralogs reveals conservation of specific residues proposed to be involved in substrate interaction . These include positively charged residues (arginines and lysines) that interact with the negatively charged phosphate groups of ATP and Pi, and coordinating residues that can interact with the Mg²⁺ ion complexed with ATP.

Mouse SCaMC-1L conserves these substrate-interaction residues at equivalent positions, suggesting functional conservation of transport specificity across paralogs . The exact positioning of these residues creates a substrate cavity that precisely accommodates ATP-Mg and phosphate, discriminating against other metabolites.

Transport Mechanism:
The carrier likely operates through an alternating access mechanism, where conformational changes alternate the exposure of the substrate-binding site between the matrix and intermembrane space sides of the inner mitochondrial membrane. This conformational cycling enables the exchange of ATP-Mg for phosphate.

The molecular dynamics simulation studies of mutant SCaMC-1 (SLC25A24) associated with Fontaine syndrome predict that mutations can narrow the substrate cavity and disrupt transporter dynamics . This provides indirect evidence for the importance of the substrate cavity dimensions in determining transport specificity and efficiency.

Regulatory Influences:
The calcium-binding N-terminal domain likely modulates the conformation of the carrier domain, affecting substrate binding affinity or the rate of conformational changes during the transport cycle. This regulation allows calcium signals to fine-tune transport activity while maintaining substrate specificity.

Understanding these molecular determinants of substrate specificity could inform the design of small molecules that modulate SCaMC-1 transport activity, potentially providing therapeutic approaches for cancer and other conditions where SCaMC-1 function is implicated.

How does the distribution of SCaMC-1 isoforms and splice variants contribute to tissue-specific functions?

The SCaMC family displays a complex pattern of isoform distribution and alternative splicing that likely contributes to tissue-specific functions and differential regulation. This complexity is particularly evident in SCaMC-2, which has four variants generated by alternative splicing .

SCaMC Isoform Distribution:
The SCaMC subfamily includes three genes (SCaMC-1, SCaMC-2, and SCaMC-3) that code for highly conserved proteins sharing 70-80% sequence identity . Despite this high conservation, tissue distribution patterns appear to differ:

  • SCaMC-1: The human ortholog of rabbit Efinal protein, initially reported in peroxisomes but later confirmed to be exclusively mitochondrial

  • SCaMC-2: The human ortholog of rat MCSC protein, which was described as upregulated by dexamethasone in AR42J cells

  • SCaMC-1L: A fifth SCaMC paralog found in specific tissues including male germ cells

Splice Variant Functional Diversity:
SCaMC-2 has four variants generated by alternative splicing, resulting in proteins with a common C-terminus but variations in their N-terminal halves . These variations include the loss of one to three EF-hand motifs , suggesting differential calcium sensitivity among the variants. This arrangement could allow for fine-tuning of calcium responsiveness in different tissues or under different physiological conditions.

Tissue-Specific Expression and Function:
SCaMC-1L shows a specific distribution pattern, being detected in male germ cells and associated with structures like the chromatoid body (CB) in round spermatids and inter-mitochondrial cement (IMC) in pachytene spermatocytes . This localization pattern suggests specialized functions in male reproduction, potentially related to RNA metabolism or mitochondrial regulation during spermatogenesis.

The distinctive expression patterns and subcellular localizations of SCaMC family members likely contribute to tissue-specific mitochondrial functions:

  • Differential calcium sensitivity: Variants with fewer EF-hand motifs may respond differently to calcium signals

  • Metabolic specialization: Tissue-specific expression may align with particular metabolic requirements

  • Developmental regulation: Expression patterns may change during development to accommodate shifting energetic demands

This complexity makes SCaMC one of the most diverse subfamilies of mitochondrial carriers , suggesting that the large number of isoforms and splice variants confer different calcium sensitivity to the transport activity of these carriers in a tissue-specific manner .

What technical challenges exist in developing specific inhibitors for SCaMC-1 as potential cancer therapeutics?

Developing specific inhibitors for SCaMC-1 as cancer therapeutics presents several technical challenges that researchers must address:

Challenge 1: Structural Similarity Within the Mitochondrial Carrier Family
SCaMC-1 shares considerable structural homology with other mitochondrial carriers, making selective targeting difficult. The carrier domain of SCaMC-1 exhibits the characteristic tripartite structure common to all mitochondrial carriers .

Solutions:

  • Focus on unique regions of SCaMC-1, particularly the interface between the N-terminal calcium-binding domain and the carrier domain

  • Employ structure-based drug design using high-resolution structures (currently lacking for SCaMC-1)

  • Develop allosteric modulators that target non-conserved regions

Challenge 2: Mitochondrial Targeting and Bioavailability
Any potential inhibitor must cross both the cell membrane and the mitochondrial membranes to reach SCaMC-1 in the inner mitochondrial membrane.

Solutions:

  • Conjugate candidate molecules with mitochondrial targeting sequences

  • Utilize lipophilic cations (e.g., triphenylphosphonium) that accumulate in mitochondria

  • Design compounds with optimal physicochemical properties for membrane permeability

Challenge 3: Distinguishing Between SCaMC-1 Isoforms
With multiple SCaMC isoforms sharing high sequence identity (70-80%) , achieving selective inhibition of SCaMC-1 over other family members requires precision.

Solutions:

  • Identify subtle differences in substrate binding pockets

  • Target isoform-specific regulatory mechanisms

  • Exploit differential expression patterns in tissues

Challenge 4: Functional Redundancy
Even with specific inhibition of SCaMC-1, functional redundancy with other transporters might limit therapeutic efficacy.

Solutions:

  • Perform combination studies with inhibitors of parallel pathways

  • Identify cancer types most dependent on SCaMC-1 (personalized approach)

  • Target contexts where SCaMC-1 is the predominant isoform

Challenge 5: Rational Design Without Complete Structural Information
The lack of high-resolution crystal structures for SCaMC-1 hampers structure-based drug design efforts.

Solutions:

  • Develop homology models based on related transporters

  • Employ fragment-based screening approaches

  • Utilize functional assays to identify compounds with desired activity profiles

Despite these challenges, the potential of SCaMC-1 as a cancer therapeutic target remains significant, given its role in desensitizing the mitochondrial permeability transition and promoting cancer cell survival .

How can advanced imaging techniques enhance our understanding of SCaMC-1 dynamics in living cells?

Advanced imaging techniques offer powerful approaches to elucidate the dynamics of SCaMC-1 in living cells, providing insights into its regulation, interactions, and functions under physiological and pathological conditions.

Super-Resolution Microscopy Applications:
Traditional microscopy techniques cannot resolve structures beyond the diffraction limit (~200-300 nm), while mitochondrial substructures and protein distributions require higher resolution.

  • STED (Stimulated Emission Depletion) Microscopy: Can achieve resolution of 20-50 nm, allowing visualization of SCaMC-1 distribution across mitochondrial subcompartments

  • PALM/STORM (Photoactivated Localization/Stochastic Optical Reconstruction Microscopy): Can map the precise localization of individual SCaMC-1 molecules within mitochondria with 10-20 nm resolution

  • Structured Illumination Microscopy (SIM): Offers ~100 nm resolution with less photodamage, suitable for longer live-cell imaging

Live-Cell Calcium and Protein Dynamics:
Understanding the relationship between calcium signals and SCaMC-1 activity requires simultaneous monitoring of both parameters.

  • FRET (Förster Resonance Energy Transfer) Sensors: By tagging SCaMC-1 with appropriate fluorophores, conformational changes upon calcium binding can be detected in real-time

  • Genetically-Encoded Calcium Indicators: Combined with fluorescently-tagged SCaMC-1 to correlate calcium signals with protein relocalization or conformational changes

  • Optogenetic Calcium Mobilization: Allows precise spatiotemporal control of calcium levels to study SCaMC-1 responses

Protein-Protein Interaction Visualization:
SCaMC-1 function likely involves interactions with other mitochondrial proteins and calcium signaling components.

  • Split-Fluorescent Protein Complementation: To visualize interactions between SCaMC-1 and potential binding partners

  • Proximity Ligation Assay (PLA): For detecting endogenous protein interactions with spatial resolution

  • FRAP (Fluorescence Recovery After Photobleaching): To measure SCaMC-1 mobility and binding dynamics within mitochondrial membranes

Correlative Microscopy Approaches:
Combining different imaging modalities can provide comprehensive views of SCaMC-1 biology.

  • CLEM (Correlative Light and Electron Microscopy): Links functional observations by fluorescence microscopy with ultrastructural details by electron microscopy

  • Cryo-EM Tomography: Provides molecular-resolution images of SCaMC-1 in its native membrane environment

Image Analysis Innovations:
Advanced computational approaches maximize information extraction from imaging data.

  • Single-Particle Tracking: Follows individual SCaMC-1 molecules to determine diffusion characteristics and binding events

  • Machine Learning-Based Segmentation: Automatically identifies and classifies mitochondrial morphologies associated with different SCaMC-1 functional states

  • Quantitative Image Analysis: Measures parameters such as protein clustering, co-localization coefficients, and signal correlation in space and time

These advanced imaging approaches will be essential for understanding how SCaMC-1 dynamics correlate with mitochondrial function, calcium homeostasis, and cell survival in both normal and pathological contexts.

What are the most promising future research directions for understanding SCaMC-1's role in cellular stress responses and disease?

The study of SCaMC-1 (SLC25A24) presents several promising research directions that could significantly advance our understanding of mitochondrial biology, stress responses, and disease mechanisms. The following areas represent particularly valuable avenues for future investigation:

1. Comprehensive Structural Analysis
Despite its importance in cellular function, high-resolution structures of SCaMC-1 in different conformational states remain unavailable. Future research should prioritize:

  • Cryo-EM studies of SCaMC-1 in different calcium-bound states

  • Structural investigation of the interface between the calcium-binding and carrier domains

  • Comparative structural analysis across SCaMC family members to understand isoform-specific functions

2. Systems Biology Approaches to SCaMC-1 Networks
Understanding SCaMC-1 in the context of broader cellular networks will provide insights into its integrated functions:

  • Interactome mapping using proximity labeling techniques (BioID, APEX)

  • Multi-omics approaches (proteomics, metabolomics) in SCaMC-1 deficient models

  • Network analysis to identify critical nodes connecting SCaMC-1 to stress response pathways

3. SCaMC-1 in Aging and Age-Related Diseases
The association of SCaMC-1 mutations with Fontaine syndrome, characterized by premature aging , suggests broader implications in normal aging processes:

  • Investigation of SCaMC-1 expression and function changes during normal aging

  • Analysis of mitochondrial calcium handling in age-related neurodegenerative diseases

  • Potential connections to mitochondrial dysfunction in sarcopenia and frailty

4. Therapeutic Targeting Strategies
Building on SCaMC-1's role in cancer cell survival , development of therapeutic approaches should focus on:

  • Small molecule screens for SCaMC-1 modulators using functional transport assays

  • Peptide-based inhibitors targeting the calcium-sensing domain

  • Combination approaches with mitochondrial permeability transition pore modulators

5. Tissue-Specific Functions in Development and Disease
The complex expression pattern and splice variants of SCaMC family members suggest tissue-specific roles :

  • Conditional knockout models targeting specific tissues and developmental stages

  • Investigation of SCaMC-1L function in male fertility and reproduction

  • Exploration of potential roles in tissue-specific metabolic regulation

6. Integration with Calcium Signaling Networks
As a calcium-regulated transporter, SCaMC-1 likely participates in complex calcium signaling networks:

  • Dissection of the spatiotemporal relationship between cytosolic calcium signals and SCaMC-1 activation

  • Investigation of potential calcium microdomains between endoplasmic reticulum and mitochondria

  • Analysis of calcium signal integration across multiple calcium-responsive mitochondrial proteins

These research directions would not only advance our fundamental understanding of SCaMC-1 biology but could also identify novel therapeutic targets for cancer, metabolic disorders, and age-related diseases where mitochondrial calcium dysregulation plays a central role.

What is the current consensus on SCaMC-1's importance as a therapeutic target versus a biomarker in disease?

The evolving understanding of SCaMC-1 (SLC25A24) points to its dual potential as both a therapeutic target and a biomarker in disease contexts, particularly in cancer. Current evidence supports several key perspectives:

As a Therapeutic Target:
SCaMC-1 has emerged as a promising therapeutic target based on several lines of evidence. Its overexpression is a general feature of transformed and cancer cells, suggesting a selective advantage for these cells . Mechanistically, SCaMC-1 exerts negative feedback control between cellular calcium overload and mitochondrial permeability transition-dependent cell death . Knockdown studies have demonstrated that reducing SCaMC-1 levels sensitizes cells to mPT-mediated necrotic death triggered by oxidative stress and calcium overload .

These findings position SCaMC-1 as a potential target for cancer therapy strategies aimed at restoring sensitivity to cell death pathways. The specificity of this approach is enhanced by the apparent cancer-specific overexpression pattern, potentially providing a therapeutic window that could minimize effects on normal tissues.

As a Biomarker:
The consistent overexpression of SCaMC-1 in transformed and cancer cells also suggests utility as a biomarker . This expression pattern could potentially serve in:

  • Diagnostic applications to distinguish malignant from benign tissues

  • Prognostic assessment, if expression levels correlate with disease outcomes

  • Predictive biomarker applications for identifying tumors likely to respond to therapies targeting mitochondrial metabolism or cell death pathways

Current Research Status:
While the foundational research supports SCaMC-1's importance in both capacities, the field remains in relatively early stages of translation. Several factors influence the current consensus:

  • Specificity challenges: Targeting mitochondrial carriers selectively presents technical difficulties

  • Complex biology: The presence of multiple SCaMC isoforms and splice variants complicates both targeting and biomarker applications

  • Limited clinical validation: Most evidence comes from cellular and molecular studies rather than clinical trials

Emerging Directions:
The discovery of SCaMC-1 mutations in Fontaine syndrome has expanded interest beyond cancer to include developmental and aging-related processes . This broader disease relevance enhances its importance as a research target, potentially leading to diverse therapeutic applications.

The current consensus suggests that SCaMC-1 holds significant promise in both capacities, with perhaps stronger near-term potential as a biomarker while therapeutic targeting approaches continue to develop.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.