Recombinant Human Calcium-binding mitochondrial carrier protein SCaMC-3 (SLC25A23)

Shipped with Ice Packs
In Stock

Description

Functional Roles

SCaMC-3 mediates two primary functions:

Calcium-Regulated Adenine Nucleotide Transport

  • Exports mitochondrial phosphate while importing ATP-Mg, adjusting the matrix adenine nucleotide pool in response to cellular energy demands .

  • Half-maximal activation occurs at ~3.3 µM Ca²⁺, linking its activity to cytosolic calcium fluctuations .

Mitochondrial Calcium Homeostasis

  • Enhances mitochondrial Ca²⁺ uptake by interacting with the MCU (mitochondrial calcium uniporter) and MICU1 .

  • Knockdown reduces cytosolic Ca²⁺ clearance after stimulation, impairing mitochondrial Ca²⁺ buffering .

Neuroprotection Against Excitotoxicity

  • SCaMC-3-KO neurons exhibit accelerated Ca²⁺ deregulation and mitochondrial ATP depletion during NMDA-induced excitotoxicity .

  • Restoring SCaMC-3 stabilizes mitochondrial adenine nucleotides, delaying cell death .

Calcium-Dependent Regulation Mechanism

  • Calcium binding induces a conformational shift, releasing the amphipathic α-helix to enable transport .

  • EGTA (calcium chelator) inhibits ATP transport by stabilizing the inactive state .

Pathophysiological Implications

  • Overexpression in cancer cells increases mitochondrial calcium precipitation, evading apoptosis .

  • Variants lacking exon 10 show impaired mitochondrial import, suggesting isoform-specific functional differences .

Experimental Applications

Recombinant SCaMC-3 is widely used in:

ApplicationProtocol Details
Western Blot (WB)Dilution 1:1000–1:4000; detects ~49–54 kDa bands in mouse tissues and cell lines
Functional Transport AssaysReconstituted in liposomes to measure ATP-Mg/Pi exchange rates under varying Ca²⁺
Calcium Binding StudiesFluorescence-based assays using EF-hand mutants to assess Ca²⁺ affinity

Clinical and Therapeutic Relevance

  • Neurodegenerative Diseases: SCaMC-3 deficiency exacerbates neuronal damage in excitotoxicity models, highlighting its neuroprotective role .

  • Cancer: Overexpression correlates with chemoresistance by modulating mitochondrial calcium and ATP dynamics .

Outstanding Questions

  1. How do splice variants (e.g., SCaMC-3b) affect mitochondrial function in vivo?

  2. What structural determinants govern SCaMC-3 interaction with MCU/MICU1?

  3. Can pharmacological modulation of SCaMC-3 enhance neuroprotection or cancer therapy?

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be established during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
SLC25A23; APC2; MCSC2; SCAMC3; Calcium-binding mitochondrial carrier protein SCaMC-3; Mitochondrial ATP-Mg/Pi carrier protein 2; Mitochondrial Ca(2+-dependent solute carrier protein 2; Small calcium-binding mitochondrial carrier protein 3; Solute carrier family 25 member 23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-468
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SLC25A23
Target Protein Sequence
MRGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDA DPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEK ILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTVLDIGECLTVPDEFSKQEK LTGMWWKQLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKTNRLNILGGLRSMVLEGGIRS LWRGNGINVLKIAPESAIKFMAYEQIKRAILGQQETLHVQERFVAGSLAGATAQTIIYPM EVLKTRLTLRRTGQYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLK NWWLQQYSHDSADPGILVLLACGTISSTCGQIASYPLALVRTRMQAQASIEGGPQLSMLG LLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR
Uniprot No.

Target Background

Function
Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers transport metabolites, nucleotides, and cofactors across the mitochondrial inner membrane. SCaMC-3 may function as an ATP-Mg/Pi exchanger, mediating the transport of Mg-ATP in exchange for phosphate, thereby facilitating the net uptake or efflux of adenine nucleotides into or from the mitochondria. It also serves as a regulator of mitochondrial calcium uptake through interaction with MCU and MICU1.
Gene References Into Functions
  1. Direct measurements of Mg(2+), Mn(2+), Fe(2+), Zn(2+) and Cu(2+) have shown that they are cotransported with ATP by both hAPCs and AtAPCs. It is likely that in vivo APCs transport free ATP and ATP-Mg complex to varying degrees, and potentially trace amounts of other Metals(2+) in complex with ATP. PMID: 28695448
  2. Our research revealed that EZH2 is significantly overexpressed in astrocytic tumors, exhibiting a strong positive correlation with tumor grade. We identified SLC25A23 as a crucial target of H3K27me3 modification, which is downregulated in GBM and its low expression is associated with poor prognosis in glioblastomas (GBMs). PMID: 27993893
  3. SLC25A23 enhances mitochondrial Ca(2) uptake, interacts with MCU, and induces oxidative stress-mediated cell death. PMID: 24430870
  4. SCaMC-3 is a member of a novel human subfamily of mitochondrial carriers that possess calcium-binding domains. PMID: 15054102
  5. Identification of three isoforms of the mitochondrial ATP-Mg/Pi carrier APC1, APC2 and APC3; they are most likely responsible for the net uptake or efflux of adenine nucleotides into or from the mitochondria. PMID: 15123600
  6. Northern blot analysis indicates the presence of the transcript in brain, heart, skeletal muscle, liver and small intestine. The SLC25A23 gene undergoes alternative splicing, suggesting a modular nature of the encoded product. PMID: 15716113

Show More

Hide All

Database Links

HGNC: 19375

OMIM: 608746

KEGG: hsa:79085

UniGene: Hs.356231

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Present in various cell lines (at protein level). Expressed at low levels in most tissues examined, with highest expression in brain, skeletal muscle and pancreas.

Q&A

What is SCaMC-3/SLC25A23 and to which protein family does it belong?

SCaMC-3 (Small Calcium-binding Mitochondrial Carrier 3), also known as SLC25A23 or APC2, belongs to the mitochondrial carrier family (SLC25), which comprises 53 members in humans, making it the largest solute transporter family. SCaMC-3 specifically functions as a calcium-regulated ATP-Mg/Pi carrier, located in the inner mitochondrial membrane. It is one of four ATP-Mg/Pi carrier isoforms (APCs) in humans, with the others being APC1 (SLC25A24), APC3 (SLC25A25), and APC4 (SLC25A41) .

Unlike standard mitochondrial carriers which have a six transmembrane domain structure, SCaMC-3 has a distinctive three-domain architecture consisting of:

  • An N-terminal calcium-regulatory domain containing four EF-hand motifs

  • An amphipathic helix

  • A C-terminal carrier domain responsible for substrate transport

This structure allows SCaMC-3 to respond to calcium signals, distinguishing it from many other mitochondrial carriers.

What is the primary function of SCaMC-3 in mitochondria?

SCaMC-3 performs an electroneutral exchange of ATP-Mg²⁻ or HADP²⁻ for HPO₄²⁻ across the inner mitochondrial membrane in a calcium-dependent manner. This transport mechanism results in changes to the total adenine nucleotide (AdN) concentration in the mitochondrial matrix. Key aspects of its function include:

  • Calcium regulation: SCaMC-3 is activated by cytosolic calcium, with half-maximal activation occurring at approximately 3.3 μM Ca²⁺

  • Bioenergetic regulation: By facilitating the transport of ATP-Mg or ADP into mitochondria, SCaMC-3 helps maintain adequate levels of adenine nucleotides in the matrix, which are essential for mitochondrial function

  • Enhanced calcium handling: SCaMC-3 activity increases the calcium retention capacity (CRC) of mitochondria

  • Protection against excitotoxicity: SCaMC-3 counteracts PARP-1-dependent depletion of mitochondrial ATP levels during excitotoxic stress

This transport function distinguishes SCaMC-3 from the ADP/ATP carrier, which exchanges matrix ATP for cytosolic ADP in an electrogenic manner and is not directly regulated by calcium.

Where is SCaMC-3 primarily expressed in the body?

SCaMC-3 is predominantly expressed in liver and brain tissues . In the brain, it plays a particularly important role in neuronal mitochondria, where it contributes to bioenergetic adaptation during excitatory signaling and protection against excitotoxic damage. The specific expression pattern within brain regions and cell types has not been fully detailed in the provided search results, but its functional importance in cortical neurons has been demonstrated through experiments with SCaMC-3 knockout models .

How is SCaMC-3 activity regulated?

SCaMC-3 activity is primarily regulated by cytosolic calcium through its N-terminal domain containing four EF-hand motifs. The regulatory mechanism involves:

  • Calcium sensing: The EF-hand motifs in the N-terminal domain face the intermembrane space (equivalent to the cytosolic side) and bind Ca²⁺ with moderate affinity (half-maximal activation at ~3.3 μM)

  • Conformational changes: Calcium binding to the EF-hands induces conformational changes that activate the carrier domain

  • Transport activation: When activated by calcium, SCaMC-3 mediates the exchange of ATP-Mg²⁻ or HADP²⁻ for HPO₄²⁻, increasing the total adenine nucleotide content in the mitochondrial matrix

This calcium-dependent regulation allows SCaMC-3 to respond to cellular signaling events that involve calcium elevation, such as those occurring during neuronal activation or excitotoxic stress.

What is the mechanistic role of SCaMC-3 in protecting neurons against excitotoxicity?

SCaMC-3 protects neurons against excitotoxicity through a multi-step mechanism that counters the bioenergetic crisis induced by excessive NMDA receptor activation. Experimental data from SCaMC-3 KO neurons reveals the following protective mechanisms:

  • Maintenance of mitochondrial ATP levels:

    • NMDA receptor activation triggers PARP-1 (Poly(ADP-ribose) polymerase-1), which can deplete cellular NAD⁺ and ATP

    • SCaMC-3 counteracts this by transporting ATP-Mg or ADP into mitochondria, maintaining matrix adenine nucleotide levels

    • SCaMC-3 KO neurons show a rapid fall in mitochondrial ATP following NMDA exposure, while wild-type neurons maintain ATP levels

  • Enhanced respiratory response:

    • SCaMC-3 activity is associated with robust increases in mitochondrial respiration following NMDA stimulation

    • SCaMC-3 KO neurons show blunted respiratory responses to NMDA

  • Increased mitochondrial calcium retention capacity:

    • SCaMC-3-mediated adenine nucleotide transport enhances the calcium buffering ability of mitochondria

    • SCaMC-3-deficient mitochondria have reduced calcium retention capacity compared to wild-type

  • Delayed calcium deregulation prevention:

    • SCaMC-3 KO neurons exhibit earlier delayed calcium deregulation following excitotoxic stimulation

    • This premature calcium deregulation in SCaMC-3 KO neurons appears to result from failure to maintain matrix adenine nucleotides

These protective mechanisms function collectively to maintain bioenergetic homeostasis during excitotoxic stress, ultimately improving neuronal survival.

How does SCaMC-3 interact with PARP-1 signaling during excitotoxicity?

The interaction between SCaMC-3 and PARP-1 signaling during excitotoxicity represents a critical intersection of bioenergetic regulation and stress response pathways:

  • Opposing mechanisms:

    • PARP-1 activation by NMDA receptor stimulation leads to NAD⁺ consumption and subsequent ATP depletion

    • SCaMC-3 counters this effect by facilitating adenine nucleotide transport into mitochondria, thus maintaining ATP production capacity

  • Temporal dynamics:

    • PARP-1 activation occurs rapidly following NMDA receptor stimulation

    • SCaMC-3 activation by rising cytosolic calcium occurs simultaneously

    • The balance between these opposing processes determines mitochondrial ATP levels during the early phase of excitotoxicity

  • Experimental validation:

    • In SCaMC-3 KO neurons, NMDA exposure results in rapid mitochondrial ATP depletion

    • PARP-1 inhibitors prevent this ATP depletion in SCaMC-3 KO neurons

    • This demonstrates that PARP-1 activation is responsible for the ATP decline that SCaMC-3 normally counteracts

  • Functional consequences:

    • When SCaMC-3 activity is insufficient to counter PARP-1-mediated ATP depletion, mitochondria lose their ability to maintain calcium homeostasis

    • This leads to premature delayed calcium deregulation and ultimately neuronal death

This interaction highlights SCaMC-3's role as a bioenergetic safeguard against the metabolic consequences of PARP-1 activation during excitotoxic stress.

What distinguishes SCaMC-3 from other mitochondrial carrier family members in structure and function?

SCaMC-3 possesses several distinct structural and functional features that differentiate it from standard mitochondrial carriers:

Structural Distinctions:

  • Three-domain architecture:

    • SCaMC-3 has an N-terminal calcium-regulatory domain with four EF-hands

    • An amphipathic helix connects the regulatory and carrier domains

    • Standard mitochondrial carriers typically lack regulatory domains

  • Calcium-binding motifs:

    • The EF-hand motifs in SCaMC-3 face the intermembrane space

    • Most mitochondrial carriers lack calcium-sensing capability

  • Conservation patterns:

    • While SCaMC-3 shares the carrier domain structure common to the SLC25 family, its calcium-regulatory domain is unique to the ATP-Mg/Pi carrier subfamily

    • Only four members of the SLC25 family (APC1-4) have this calcium-regulatory domain structure

Functional Distinctions:

  • Transport mechanism:

    • SCaMC-3 mediates electroneutral exchange of ATP-Mg²⁻ or HADP²⁻ for HPO₄²⁻

    • This differs from the ADP/ATP carrier, which performs electrogenic exchange of ATP⁴⁻ for ADP³⁻

  • Calcium regulation:

    • SCaMC-3 activity is directly regulated by calcium binding

    • Most SLC25 carriers are not calcium-regulated

  • Physiological role:

    • SCaMC-3 modulates the total adenine nucleotide content in the matrix

    • This contrasts with the ADP/ATP carrier, which maintains the ATP/ADP ratio but doesn't change total nucleotide levels

  • Role in calcium handling:

    • SCaMC-3 enhances mitochondrial calcium retention capacity

    • This function is not shared by standard mitochondrial carriers

These distinctions position SCaMC-3 as a specialized carrier that integrates calcium signaling with bioenergetic regulation.

What is the current understanding of SCaMC-3's role in neurological disorders?

Based on experimental evidence, SCaMC-3 appears to play a protective role against excitotoxicity, which is implicated in various neurological disorders:

  • Seizure susceptibility:

    • SCaMC-3 KO mice show increased susceptibility to kainate-induced seizures

    • This suggests SCaMC-3 may provide neuroprotection during epileptic activity

  • Excitotoxic neuronal death:

    • SCaMC-3 KO neurons exhibit higher vulnerability to glutamate/NMDA-induced excitotoxicity in vitro

    • This implicates SCaMC-3 as a potential protective factor in conditions involving excitotoxic mechanisms, such as stroke, traumatic brain injury, and neurodegenerative diseases

  • Mitochondrial dysfunction:

    • Since SCaMC-3 maintains mitochondrial adenine nucleotide levels and enhances calcium handling capacity, its dysfunction may contribute to mitochondrial impairment in neurological disorders

    • Mitochondrial dysfunction is a common feature in many neurodegenerative conditions

  • Potential therapeutic implications:

    • Enhancing SCaMC-3 function might protect against excitotoxic damage

    • Strategies to boost mitochondrial adenine nucleotide levels could potentially mimic the protective effects of SCaMC-3

While these findings suggest important roles for SCaMC-3 in neurological disorders, further research is needed to fully elucidate its contributions to specific disease states and its potential as a therapeutic target.

What are the key experimental approaches to study SCaMC-3 function?

Several complementary experimental approaches have been employed to investigate SCaMC-3 function:

  • Genetic manipulation models:

    • SCaMC-3 knockout mice: Generated by Lexicon with a mixed C57BL/6Sv129 genetic background

    • These mice are viable and born in Mendelian proportions with no evident phenotypic traits under normal conditions

    • Primary neuron cultures from SCaMC-3 KO mice provide a valuable tool for studying SCaMC-3 function in a cellular context

  • Bioenergetic assessment techniques:

    • Mitochondrial ATP measurements to assess adenine nucleotide transport

    • Respiration analysis to evaluate the impact of SCaMC-3 on mitochondrial oxygen consumption

    • These approaches have revealed blunted respiratory responses to NMDA in SCaMC-3 KO neurons

  • Calcium imaging methods:

    • Fura-2 loading for cytosolic calcium measurements

    • Mitochondrially targeted ratiometric GEM-GECO-1 for matrix calcium monitoring

    • These techniques have demonstrated earlier delayed calcium deregulation in SCaMC-3 KO neurons

  • Pharmacological interventions:

    • PARP-1 inhibitors to assess the interaction between PARP-1 activation and SCaMC-3 function

    • NMDA/glutamate exposure protocols to induce excitotoxicity

    • These approaches have shown that PARP-1 inhibition prevents ATP depletion in SCaMC-3 KO neurons

  • Mitochondrial functional assays:

    • Calcium retention capacity measurements to evaluate mitochondrial calcium handling

    • These assays have revealed reduced calcium retention capacity in SCaMC-3-deficient mitochondria

  • Cell viability assessment:

    • Calcein-AM versus propidium iodide staining for viability determination

    • These methods have demonstrated increased vulnerability of SCaMC-3 KO neurons to excitotoxicity

Collectively, these approaches provide a comprehensive toolkit for investigating SCaMC-3 function at molecular, cellular, and organismal levels.

How should researchers isolate and purify recombinant SCaMC-3 protein for structural and functional studies?

To isolate and purify recombinant SCaMC-3 protein for detailed structural and functional studies, researchers should consider the following methodological approach:

  • Expression system selection:

    • Bacterial systems (E. coli): Suitable for producing the carrier domain alone

    • Eukaryotic systems (insect or mammalian cells): Preferred for full-length protein to ensure proper folding of the calcium-regulatory domain

    • Yeast systems: Often used for mitochondrial carrier proteins due to their ability to correctly fold these proteins

  • Construct design considerations:

    • Include an affinity tag (His-tag, GST-tag) for purification purposes

    • Consider expressing separate domains (calcium-binding domain vs. carrier domain) for domain-specific studies

    • For functional studies of the full protein, ensure both the N-terminal calcium-regulatory domain and the C-terminal carrier domain are intact

  • Solubilization and purification strategy:

    • Use mild detergents suitable for membrane proteins (n-dodecyl-β-D-maltoside or digitonin) for extraction

    • Employ affinity chromatography for initial purification

    • Follow with size exclusion chromatography to achieve high purity

    • Include calcium in buffers when appropriate to stabilize the calcium-binding domain

  • Quality control assessments:

    • SDS-PAGE and Western blotting to confirm protein identity and purity

    • Circular dichroism spectroscopy to assess proper folding

    • Dynamic light scattering to evaluate homogeneity

    • Mass spectrometry to confirm protein integrity

  • Functional validation:

    • Calcium binding assays to verify EF-hand functionality

    • Reconstitution into liposomes for transport assays

    • ATP-Mg/Pi exchange measurements to confirm carrier activity

    • Evaluation of calcium-dependent activation using varying calcium concentrations

  • Structural studies preparation:

    • For crystallography: Screen multiple detergents and crystallization conditions

    • For cryo-EM: Consider amphipol or nanodisc reconstitution to maintain native structure

    • For NMR studies: Consider domain-specific analysis, particularly of the calcium-binding domain

This comprehensive approach allows for the production of high-quality recombinant SCaMC-3 protein suitable for detailed structural and functional characterization.

What are the optimal conditions for measuring SCaMC-3 transport activity in isolated mitochondria?

To accurately measure SCaMC-3 transport activity in isolated mitochondria, researchers should establish the following experimental conditions:

  • Mitochondrial isolation:

    • Use gentle isolation procedures to maintain mitochondrial integrity

    • Isolate mitochondria from SCaMC-3-expressing tissues (liver or brain)

    • Include protease inhibitors to prevent protein degradation

    • Assess mitochondrial integrity using standard markers (respiratory control ratio, membrane potential)

  • Buffer composition:

    • Base medium: 250 mM sucrose, 10 mM HEPES, pH 7.4

    • Include 5-10 mM succinate or glutamate/malate as respiratory substrates

    • Add 1-2 μM rotenone when using succinate to prevent reverse electron flow

    • Supplement with 0.5-1 mM MgCl₂ for ATP-Mg transport measurements

  • Calcium regulation consideration:

    • Control calcium levels precisely using calcium buffers (EGTA/calcium mixtures)

    • Test a range of calcium concentrations (0.1-10 μM) to observe calcium-dependent activation

    • Include conditions with calcium chelators (EGTA) as negative controls

    • Remember that half-maximal activation occurs at ~3.3 μM Ca²⁺

  • Transport measurement approaches:

    • Radioisotope method:

      • Use ³H-ATP or ¹⁴C-ADP to track substrate transport

      • Measure time-dependent uptake by rapid filtration and scintillation counting

      • Include atractyloside to inhibit the ADP/ATP carrier and isolate SCaMC-3-specific transport

    • HPLC-based assay:

      • Measure changes in matrix adenine nucleotide content by HPLC analysis

      • Sample mitochondria at various time points after substrate addition

      • Extract adenine nucleotides using perchloric acid extraction

    • Luminescence-based ATP detection:

      • Use luciferase-based assays to measure changes in extra-mitochondrial ATP

      • Monitor in real-time the exchange of external ATP-Mg for matrix Pi

  • Controls and validation:

    • Perform parallel measurements with mitochondria from SCaMC-3 KO tissues

    • Use specific inhibitors of other carriers to ensure specificity

    • Confirm calcium-dependence by conducting assays with and without calcium

  • Data analysis:

    • Calculate initial rates of transport under various conditions

    • Determine kinetic parameters (Km, Vmax) for ATP-Mg and Pi

    • Establish the calcium-dependence curve and calculate EC₅₀ for calcium activation

These methodological considerations ensure accurate and reproducible assessment of SCaMC-3 transport activity in isolated mitochondria.

Comparative Properties of Mitochondrial Carrier Family Members Related to SCaMC-3

Carrier ProteinGene NameSubstratesRegulatory MechanismExpression PatternSpecial Features
SCaMC-3SLC25A23ATP-Mg²⁻/HADP²⁻ ↔ HPO₄²⁻Ca²⁺-regulated via 4 EF-handsLiver, brainCa²⁺ activation at ~3.3 μM
SCaMC-1/APC1SLC25A24ATP-Mg²⁻/HADP²⁻ ↔ HPO₄²⁻Ca²⁺-regulated via 4 EF-handsWidespreadThree-domain structure
SCaMC-2/APC3SLC25A25ATP-Mg²⁻/HADP²⁻ ↔ HPO₄²⁻Ca²⁺-regulated via 4 EF-handsWidespreadThree-domain structure
APC4SLC25A41ATP-Mg²⁻/HADP²⁻ ↔ HPO₄²⁻Not Ca²⁺-regulatedLimitedLacks regulatory domain
ADP/ATP CarrierSLC25A4-6ATP⁴⁻ ↔ ADP³⁻Not Ca²⁺-regulatedWidespreadElectrogenic exchange
AGC1SLC25A12Glutamate+H⁺ ↔ AspartateCa²⁺-regulated via 8 EF-handsNeural tissueForms dimers
AGC2SLC25A13Glutamate+H⁺ ↔ AspartateCa²⁺-regulated via 8 EF-handsLiver, other tissuesForms dimers

Functional Consequences of SCaMC-3 Deficiency in Neuronal Excitotoxicity Models

ParameterWild-type NeuronsSCaMC-3 KO NeuronsSignificance
Mitochondrial ATP levels after NMDAMaintainedRapid decreaseSCaMC-3 preserves mitochondrial ATP during excitotoxicity
Respiratory response to NMDARobust increaseBlunted responseSCaMC-3 facilitates respiratory adaptation
Delayed Ca²⁺ deregulation timingLaterEarlierSCaMC-3 delays catastrophic Ca²⁺ increase
Mitochondrial Ca²⁺ retention capacityHigherLowerSCaMC-3 enhances mitochondrial Ca²⁺ buffering
Vulnerability to excitotoxicity in vitroLowerHigherSCaMC-3 protects against excitotoxic cell death
Kainate-induced seizure susceptibilityLowerHigherSCaMC-3 provides protection in vivo
Effect of PARP-1 inhibitorsMinimalPrevents ATP decreasePARP-1 mediates ATP depletion counteracted by SCaMC-3

What are the most promising future research directions for SCaMC-3 studies?

Based on current knowledge of SCaMC-3 function and its role in excitotoxicity, several promising research directions emerge:

  • Structural studies:

    • Determination of the complete 3D structure of SCaMC-3, particularly focusing on the calcium-binding domain and its interaction with the carrier domain

    • Investigation of the conformational changes induced by calcium binding

    • Structure-based design of modulators to enhance SCaMC-3 activity

  • Physiological and pathological roles:

    • Further characterization of SCaMC-3's role in various neurological disorders beyond excitotoxicity

    • Investigation of tissue-specific functions in liver versus brain

    • Exploration of potential roles in aging and metabolic disorders

  • Therapeutic potential:

    • Development of small molecules that enhance SCaMC-3 activity as potential neuroprotective agents

    • Evaluation of SCaMC-3 as a target for preventing excitotoxic damage in stroke, traumatic brain injury, and neurodegenerative diseases

    • Investigation of gene therapy approaches to upregulate SCaMC-3 in vulnerable neural populations

  • Regulatory mechanisms:

    • Further characterization of factors beyond calcium that may regulate SCaMC-3 function

    • Investigation of post-translational modifications affecting SCaMC-3 activity

    • Study of transcriptional and translational regulation of SCaMC-3 expression

  • Interaction with cellular pathways:

    • Deeper exploration of SCaMC-3's interaction with PARP-1 signaling

    • Investigation of crosstalk with other calcium signaling pathways

    • Characterization of SCaMC-3's role in mitochondrial quality control mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.