Recombinant Human Calcium channel flower homolog (CACFD1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Calcium Channel Flower Homolog (CACFD1)

Recombinant Human Calcium Channel Flower Homolog (CACFD1) is a protein produced through recombinant DNA technology, specifically in an in vitro E. coli expression system . This protein is associated with the CACFD1 gene, which encodes a protein known as Flower (hFWE) in humans . The CACFD1 gene is also referred to as C9ORF7 and plays a significant role in cell recognition and selection mechanisms, influencing oncogenic growth .

Gene and Protein Overview

The CACFD1 gene is a protein-coding gene located in humans and other species like mice. It generates multiple protein-coding splice variants, which are crucial for cell-cell interactions and competitive growth advantages in cancer cells . The gene is associated with several diseases, including hyperphenylalaninemia .

Key Features of CACFD1 Gene and Protein:

  • Gene ID: 11094 in humans .

  • Protein Variants: Generates four protein-coding splice variants (hFWE1–hFWE4) .

  • Function: Involved in cell recognition and selection, affecting oncogenic growth .

Recombinant Production

Recombinant Human Calcium Channel Flower Homolog (CACFD1) is produced using an in vitro E. coli expression system. This method allows for high purity and controlled production of the protein, which is essential for research and potential therapeutic applications .

Production Details:

  • Expression System: In vitro E. coli .

  • Purity: High purity .

  • Availability: Available for purchase from specific suppliers .

Research Findings and Applications

Research on CACFD1 has shown its involvement in promoting competitive growth in cancer cells. The inhibition of Flower proteins (including CACFD1) can reduce tumor growth and metastasis, making them potential targets for cancer therapy .

Key Research Findings:

  • Cancer Growth: Increased expression of Win isoforms of Flower proteins confers a competitive growth advantage on cancer cells .

  • Therapeutic Potential: Inhibition of Flower proteins can induce sensitivity to chemotherapy and reduce tumor growth .

Interaction with Chemical Compounds

CACFD1 expression can be influenced by various chemical compounds. For example, certain chemicals like 2,3,7,8-tetrachlorodibenzodioxin increase CACFD1 mRNA expression, while others like benzo(a)pyrene decrease it .

Chemical Interactions:

Chemical CompoundEffect on CACFD1 Expression
2,3,7,8-TetrachlorodibenzodioxinIncreases expression
Benzo(a)pyreneDecreases expression
AcrylamideIncreases expression
Cadmium DichlorideDecreases expression

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CACFD1; C9orf7; PSEC0107; PSEC0248; UNQ3071/PRO9903; Calcium channel flower homolog; Calcium channel flower domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-172
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CACFD1
Target Protein Sequence
MSSSGGAPGASASSAPPAQEEGMTWWYRWLCRLSGVLGAVSCAISGLFNCITIHPLNIAA GVWMIMNAFILLLCEAPFCCQFIEFANTVAEKVDRLRSWQKAVFYCGMAVVPIVISLTLT TLLGNAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLEGEL
Uniprot No.

Target Background

Database Links

HGNC: 1365

OMIM: 613104

KEGG: hsa:11094

UniGene: Hs.62003

Protein Families
Calcium channel flower family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of human CACFD1 protein?

Human CACFD1 is a 171 amino acid transmembrane protein with a hydropathy profile predicting three to four transmembrane domains . Topological studies using pH-sensitive fluorophores like pHluorin fused to different domains have confirmed that both the C-terminus and the region between the predicted second and third transmembrane domains reside in the cytoplasm . The protein contains specific structural motifs that contribute to its function in calcium-dependent processes, making its transmembrane organization critical for proper functioning.

What are the known isoforms of human CACFD1 and their functions?

Human CACFD1 has four protein-coding splice variants (isoforms) that serve as "fitness fingerprints" in competitive cellular environments:

IsoformFunctionExpression PatternCellular Implication
hFWE1 (isoform 1)Marks cells as less fit ("loser" cells)Higher in less competitive cellsIdentifies cells for potential elimination
hFWE2 (isoform 2)Promotes cellular fitness ("winner" cells)Elevated in competitively advantageous cellsConfers growth advantage, upregulated in cancer
hFWE3 (isoform 3)Similar to isoform 1, marks less fit cellsHigher in less competitive cellsIdentifies cells for potential elimination
hFWE4 (isoform 4)Promotes cellular fitness ("winner" cells)Elevated in competitively advantageous cellsConfers growth advantage, upregulated in cancer

These isoforms function as a comparative fitness sensing mechanism, where the relative expression levels between neighboring cells determine competitive outcomes in tissue environments .

How is CACFD1 involved in endocytosis?

CACFD1 functions as a critical mediator of calcium-dependent endocytosis across multiple cell types. In hippocampal neurons, it regulates two major modes of synaptic vesicle retrieval: Clathrin-mediated endocytosis (CME) in response to mild stimulation and activity-dependent bulk endocytosis (ADBE) during strong stimulation . In cytotoxic T-lymphocytes (CTLs), CACFD1 facilitates calcium-dependent endocytosis of cytotoxic granules at the immunological synapse . Experimental evidence shows that Flower-deficient CTLs exhibit a significant block in cytotoxic granule endocytosis, with granules remaining trapped at the immunological synapse rather than being efficiently internalized .

How can researchers effectively study the calcium dependency of CACFD1 function?

Researchers can investigate CACFD1's calcium dependency through several methodological approaches:

  • Calcium rescue experiments: As demonstrated in Flower-deficient CTLs, providing increased calcium concentration can rescue the endocytosis block caused by CACFD1 absence . Design experiments with calcium ionophores or varying extracellular calcium concentrations while monitoring endocytic processes.

  • Calcium imaging with fluorescent indicators: Combine live calcium imaging with CACFD1 function assays to correlate calcium fluctuations with protein activity.

  • Mutagenesis of putative calcium-binding domains: Generate point mutations in regions potentially involved in calcium sensing to determine structure-function relationships.

  • Electrophysiological approaches: Patch clamp techniques can help determine if CACFD1 itself functions as a calcium channel or modulates calcium influx through other channels.

  • Calcium chelation experiments: Use intracellular or extracellular calcium chelators (BAPTA-AM, EGTA) to determine how calcium depletion affects CACFD1-dependent processes.

These approaches should be combined with appropriate controls and quantitative readouts such as endocytosis efficiency measurements or calcium flux quantification.

What are the most effective methods to study CACFD1 isoform expression in cancer models?

To effectively study CACFD1 isoform expression in cancer models, researchers should employ the following methodological approaches:

  • Isoform-specific qRT-PCR: Design primers that specifically amplify each splice variant to quantify relative expression levels across cancer cell lines and patient samples.

  • RNA-seq with splice junction analysis: Use RNA sequencing with computational tools that detect alternative splicing to identify isoform switching in cancer progression.

  • Isoform-specific antibodies: Develop antibodies targeting unique epitopes of each isoform for western blotting, immunohistochemistry, and flow cytometry analyses.

  • CRISPR-Cas9 isoform modulation: Create cell lines with selective knockout or overexpression of specific isoforms to assess their individual contributions to cancer phenotypes.

  • Co-culture competitive growth assays: Establish mixed cell populations expressing different CACFD1 isoforms to directly observe competitive interactions between cancer cells and stromal components .

  • Patient-derived xenograft models: Analyze isoform expression patterns in tumor samples and correlate with clinical outcomes and treatment responses.

These approaches allow researchers to comprehensively profile how the "Win" isoforms (2 and 4) contribute to cancer progression and treatment resistance.

How does inhibition of CACFD1 affect cancer cell biology and treatment response?

Inhibition of CACFD1 expression produces several significant effects on cancer cell biology and treatment response:

  • Reduced tumor growth: Experimental inhibition of Flower protein expression has been shown to significantly reduce primary tumor growth rates .

  • Decreased metastatic potential: Cancer cells with reduced CACFD1 expression demonstrate impaired ability to form metastases, suggesting a role in invasion and cellular migration .

  • Enhanced chemosensitivity: CACFD1 inhibition induces increased sensitivity to chemotherapeutic agents, potentially by altering the competitive fitness signaling that allows cancer cells to survive therapeutic stress .

  • Altered cell competition dynamics: Downregulation of "Win" isoforms (2 and 4) may prevent cancer cells from outcompeting surrounding stromal cells, thereby limiting their expansion advantage .

  • Modified endocytic processes: As CACFD1 mediates endocytosis, its inhibition likely impacts receptor recycling, nutrient uptake, and cellular communication within the tumor microenvironment.

To study these effects, researchers should utilize knockdown approaches (siRNA, shRNA), CRISPR-Cas9 gene editing, and pharmacological inhibitors (when available), combined with functional assays for proliferation, migration, apoptosis, and drug response.

What are the advantages and limitations of using CACFD1 knockout cell lines in research?

Utilizing CACFD1 knockout cell lines, such as the CACFD1 KO A549 line, offers several advantages and limitations that researchers should consider:

Advantages:

  • Precise gene disruption allowing for clear interpretation of CACFD1's role in cellular processes .

  • Stable genetic modification providing consistent experimental results across studies.

  • Valuable for identifying compensatory mechanisms that emerge in the complete absence of CACFD1.

  • Useful for studying phenotypic consequences in relevant disease models, such as lung adenocarcinoma (A549 cells) .

  • Compatible with standard in vitro assays including cell viability, migration, and drug response studies .

Limitations:

  • Complete knockout may not reflect the nuanced roles of different isoforms in competitive cell interactions.

  • May induce compensatory expression of related proteins that mask some CACFD1 functions.

  • Cell line-specific effects may not generalize across different tissue types or cancer models.

  • Unable to study dose-dependent effects or isoform switching that occurs during disease progression.

  • Potential off-target effects during the knockout generation process could confound interpretation.

To address these limitations, researchers should complement knockout studies with inducible or partial knockdown systems, isoform-specific overexpression, and validation across multiple cell types.

What imaging techniques are most effective for studying CACFD1 localization and trafficking?

Several advanced imaging techniques are particularly effective for studying CACFD1 localization and trafficking:

  • Total Internal Reflection Fluorescence Microscopy (TIRFM): Optimal for visualizing membrane-proximal events, such as vesicle fusion and endocytosis. This technique has been successfully employed to visualize cytotoxic granule dynamics in Flower-deficient CTLs compared to wild-type cells .

  • Confocal live-cell imaging with fluorescent protein fusions: Tracking CACFD1 movement in real-time using constructs like Flower-pHluorin or Flower-mRFP provides insights into protein dynamics during cellular processes .

  • Correlative Light and Electron Microscopy (CLEM): Combines the molecular specificity of fluorescence microscopy with the ultrastructural detail of electron microscopy, allowing visualization of CACFD1-containing structures at the immunological synapse and early endocytic intermediates .

  • Super-resolution microscopy: Techniques like STORM, PALM, or STED can resolve CACFD1 localization beyond the diffraction limit, enabling detailed visualization of its distribution within membrane microdomains.

  • Fluorescence Recovery After Photobleaching (FRAP): Useful for measuring CACFD1 mobility within membranes and determining if it clusters at specific cellular regions during endocytosis.

For optimal results, researchers should combine these techniques with appropriate fluorescent probes and quantitative image analysis to track protein movement, colocalization with endocytic markers, and changes in response to stimuli.

How can researchers effectively differentiate between the functions of different CACFD1 isoforms?

Differentiating between CACFD1 isoform functions requires specialized experimental approaches:

  • Isoform-specific genetic manipulation: Use CRISPR-Cas9 to selectively modify each isoform or employ isoform-specific siRNAs targeting unique exon junctions.

  • Rescue experiments with individual isoforms: In CACFD1-null backgrounds, reintroduce single isoforms to determine which functions each can restore.

  • Domain swapping: Create chimeric proteins swapping regions between "Win" and "Lose" isoforms to map the specific domains responsible for their differing functions.

  • Proximity labeling proteomics: Use techniques like BioID or APEX2 fused to specific isoforms to identify unique protein interaction partners that might explain functional differences.

  • Cell competition assays: Develop quantitative assays measuring relative fitness when cells expressing different isoforms are grown in direct competition:

Experimental ConditionCell Ratio (Win:Lose) StartCell Ratio After 72hCompetitive Index
Control (no manipulation)1:1Variable based on natural fitnessBaseline
Isoform 1 vs. Isoform 21:1Isoform 2 predominatesHigher for Isoform 2
Isoform 3 vs. Isoform 41:1Isoform 4 predominatesHigher for Isoform 4
Equal expression of same isoform1:1Approximately 1:1Neutral

This systematic approach can reveal the specific contributions of each isoform to cellular fitness and competitive growth.

How should researchers address contradictory findings regarding CACFD1 function?

When encountering contradictory findings about CACFD1 function in the literature, researchers should adopt these methodological approaches:

By systematically addressing these factors, researchers can reconcile seemingly contradictory findings and develop a more nuanced understanding of CACFD1's context-dependent functions.

What are the key methodological challenges in studying CACFD1 in primary human tissues?

Studying CACFD1 in primary human tissues presents several methodological challenges:

  • Isoform-specific detection: Developing antibodies or probes that can reliably distinguish between the four CACFD1 isoforms in human tissues presents significant technical challenges.

  • Tissue heterogeneity: Primary tissues contain mixed cell populations with potentially varying CACFD1 expression patterns, making it difficult to interpret bulk analysis results.

  • Limited tissue availability: Access to relevant human tissues, particularly for longitudinal studies or rare disease conditions, can be restricted.

  • Preservation of protein localization: Standard fixation methods may disrupt the native membrane localization of CACFD1, complicating accurate determination of its subcellular distribution.

  • Functional studies in primary cells: Primary human cells often have limited lifespan in culture and may change their phenotype, potentially altering CACFD1 expression and function.

  • Context-dependent function: CACFD1's role in cell competition means its function may depend on the relative expression in neighboring cells, which is difficult to preserve in isolated primary cells.

To address these challenges, researchers should consider:

  • Single-cell RNA sequencing to resolve cell type-specific expression patterns

  • Tissue microarrays to efficiently analyze multiple patient samples

  • Ex vivo tissue slice cultures to maintain native cellular relationships

  • Advanced imaging of unfixed tissues using rapid freezing techniques

  • Patient-derived organoid models to recapitulate tissue architecture

How can CACFD1 research findings be integrated with broader cellular fitness and competition pathways?

Integrating CACFD1 research with broader cellular fitness and competition pathways requires a systems biology approach:

  • Network analysis with established fitness pathways: Connect CACFD1 signaling with known regulators of cellular fitness such as mTOR, Hippo/YAP, Myc, and p53 pathways to identify points of convergence and divergence.

  • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics data from cells with altered CACFD1 expression to build comprehensive pathway models.

  • Evolutionary conservation analysis: Examine the functional conservation of Flower proteins from Drosophila to humans to identify core mechanisms of cell competition that have been preserved throughout evolution .

  • Mathematical modeling of competitive dynamics: Develop quantitative models that predict how CACFD1 isoform ratios influence competitive outcomes in heterogeneous cell populations.

  • Drug-response correlation studies: Systematically analyze how modulation of CACFD1 affects response to drugs targeting other fitness-related pathways to identify synergistic interactions.

  • Clinical correlation studies: Connect CACFD1 isoform expression patterns with patient outcomes, treatment responses, and disease progression across various pathologies.

By integrating CACFD1 research within this broader context, researchers can develop a more comprehensive understanding of how cellular fitness sensing contributes to tissue homeostasis and disease progression, potentially revealing new therapeutic opportunities.

What are the most promising therapeutic applications targeting CACFD1 in cancer?

Based on current understanding, several promising therapeutic approaches targeting CACFD1 in cancer warrant investigation:

  • Isoform-specific inhibition: Developing compounds or RNA-based therapeutics that selectively inhibit the "Win" isoforms (2 and 4) while preserving "Lose" isoform function could reduce cancer cell competitive advantage .

  • Combination therapy strategies: Since CACFD1 inhibition increases chemosensitivity, designing rational combinations of CACFD1 targeting with conventional chemotherapeutics could enhance treatment efficacy .

  • Disruption of fitness sensing: Targeting the mechanisms by which CACFD1 isoforms signal between cells to indicate fitness status could prevent cancer cells from detecting and eliminating less fit neighboring cells.

  • Endocytosis modulation: As CACFD1 mediates endocytosis, developing approaches that specifically target CACFD1-dependent endocytic pathways in cancer cells could disrupt their nutrient acquisition and signaling .

  • Calcium signaling modification: Since CACFD1 function is calcium-dependent, selective modulation of calcium signaling in cancer cells could indirectly affect CACFD1-mediated competitive advantage .

Preliminary research suggests that inhibiting CACFD1 expression reduces tumor growth and metastasis and induces chemosensitivity, indicating significant therapeutic potential that requires further systematic investigation .

What novel experimental systems would advance our understanding of CACFD1 biology?

Development of the following experimental systems would significantly advance CACFD1 research:

  • 3D organoid co-culture systems: Creating organoids with spatially defined regions expressing different CACFD1 isoforms would enable the study of cell competition in a physiologically relevant 3D environment.

  • Inducible isoform switching models: Generating cell lines or animal models with temporally controlled expression of specific CACFD1 isoforms would facilitate the study of acute versus chronic effects of isoform changes.

  • Optical control of CACFD1 function: Developing optogenetic tools to rapidly activate or inhibit CACFD1 would allow precise temporal control over its function during dynamic cellular processes like endocytosis.

  • In vivo imaging of competition dynamics: Creating transgenic animal models expressing fluorescently tagged CACFD1 isoforms would enable visualization of cell competition processes in living tissues.

  • Patient-derived models with preserved stroma: Developing methods to maintain cancer cells alongside their native stromal environment would better recapitulate the natural competitive interactions mediated by CACFD1.

  • High-throughput screening platforms: Establishing cell-based assays suitable for large-scale screening would accelerate the discovery of compounds that modulate CACFD1 function or isoform expression.

These innovative experimental systems would provide deeper insights into CACFD1 biology and potentially identify new therapeutic strategies for diseases involving altered cellular fitness sensing.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.