Recombinant Human Calcium homeostasis modulator protein 1 (CALHM1)

Shipped with Ice Packs
In Stock

Description

Functional Properties

Recombinant CALHM1 is regulated by voltage and extracellular Ca²⁺, enabling it to modulate neuronal activity:

  • Gating Mechanism:

    • Voltage Dependence: Activated by depolarization (+60 mV) in physiological [Ca²⁺]₀ (1.5 mM) .

    • [Ca²⁺]₀ Regulation: Extracellular Ca²⁺ stabilizes the closed state (IC₅₀ = 221 μM) . Removal of Ca²⁺ increases open probability, enabling activation at negative voltages .

  • Ion Permeability:

    • Permeable to Ca²⁺, Na⁺, K⁺, and Cl⁻ (PCa/PNa ≈ 1.5) .

    • Conducts ATP, critical for neurotransmitter release in taste buds .

Functional PropertyWild-Type CALHM1D121A Mutant
Ca²⁺ SelectivityModerate (PCa/PNa ≈ 1.5) Reduced
Voltage Activation Threshold+60 mV (1.5 mM Ca²⁺) Unchanged
Response to Low [Ca²⁺]₀Enhanced conductance and excitability Impaired
ATP PermeabilityYes Not tested

Neuronal Excitability and Calcium Signaling

  • Low [Ca²⁺]₀ Response: Recombinant CALHM1 mediates cortical neuron hyperexcitability during extracellular Ca²⁺ depletion (e.g., seizures, anoxia). Calhm1 knockout (KO) neurons show 50% reduced conductance and failed action potential generation in low Ca²⁺ .

  • Calcium Homeostasis: CALHM1 elevates intracellular Ca²⁺ ([Ca²⁺]ᵢ) upon Ca²⁺ restoration after depletion, a process absent in KO neurons .

Taste Transduction

  • CALHM1 is essential for ATP release in type II taste bud cells, enabling sweet, bitter, and umami signal transmission .

Pathophysiological Implications

  • Alzheimer’s Disease: CALHM1 modulates amyloid-beta (Aβ) production via Ca²⁺-dependent regulation of amyloid precursor protein processing . The P86L polymorphism is linked to early-onset Alzheimer’s .

  • Neurotoxicity: Overexpression in C. elegans neurons causes Ca²⁺-dependent neurodegeneration, highlighting its dual role in physiology and pathology .

Experimental Models and Key Findings

Recombinant CALHM1 has been characterized in multiple systems:

Model SystemKey Findings
Xenopus OocytesDepolarization-activated currents (τ = 3 s at +60 mV); Ca²⁺-dependent gating
Mouse Cortical NeuronsCALHM1 KO abolishes low Ca²⁺-induced excitability and Ca²⁺ influx
HEK293/N2A CellsD121 mutations alter ion selectivity; Ca²⁺ addback elevates [Ca²⁺]ᵢ
C. elegansCLHM-1 (homolog) deletion causes locomotion defects; overexpression is toxic

Therapeutic and Research Applications

  • Drug Target: The CALHM1 pore (N-terminal helix) is blocked by ruthenium red, suggesting avenues for channel-specific inhibitors .

  • Tool for Calcium Signaling Studies: Recombinant CALHM1 enables dissection of [Ca²⁺]₀-dependent neuronal excitability mechanisms .

Unresolved Questions

  • Structural Dynamics: How do hexameric and octameric assemblies coexist, and what determines oligomeric state ?

  • Alzheimer’s Mechanism: Does CALHM1 directly interact with amyloid precursor protein, or does it modulate Aβ indirectly via Ca²⁺ ?

  • Taste Signaling: Are CALHM1-dependent ATP release mechanisms conserved across sensory systems ?

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CALHM1; FAM26C; Calcium homeostasis modulator protein 1; Protein FAM26C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-346
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CALHM1
Target Protein Sequence
MMDKFRMIFQFLQSNQESFMNGICGIMALASAQMYSAFDFNCPCLPGYNAAYSAGILLAP PLVLFLLGLVMNNNVSMLAEEWKRPLGRRAKDPAVLRYMFCSMAQRALIAPVVWVAVTLL DGKCFLCAFCTAVPVSALGNGSLAPGLPAPELARLLARVPCPEIYDGDWLLAREVAVRYL RCISQALGWSFVLLTTLLAFVVRSVRPCFTQAAFLKSKYWSHYIDIERKLFDETCTEHAK AFAKVCIQQFFEAMNHDLELGHTHGTLATAPASAAAPTTPDGAEEEREKLRGITDQGTMN RLLTSWHKCKPPLRLGQEEPPLMGNGWAGGGPRPPRKEVATYFSKV
Uniprot No.

Target Background

Function

CALHM1 is a pore-forming subunit of a voltage-gated ion channel crucial for the sensory perception of sweet, bitter, and umami tastes. It is specifically located in type II taste bud cells, where it plays a central role in taste perception by triggering ATP release. This ATP acts as a neurotransmitter, activating afferent neural gustatory pathways. In conjunction with CALHM3, CALHM1 forms a rapidly activating voltage-gated ATP-release channel in type II taste bud cells (TBCs). It functions as both a voltage-gated and calcium-activated ion channel, mediating neuronal excitability in response to extracellular Ca2+ concentration changes. Characterized by its poor ion selectivity and wide pore (approximately 14 Angstroms), it permits the passage of Ca2+, Na+, and K+, as well as monovalent anions. Furthermore, CALHM1 activates the ERK1/ERK2 cascade, triggers endoplasmic reticulum stress by reducing ER calcium content, and may indirectly influence amyloid precursor protein (APP) proteolysis and aggregated amyloid-beta (Aβ) peptide levels in a Ca2+-dependent manner.

Gene References Into Functions
Gene References and Associated Functions
  1. Meta-analysis suggests a potential association between CALHM1 rs2986017 and increased Alzheimer's disease risk in Caucasian, but not Asian populations. PMID: 26700797
  2. In the presence of antibodies, P86L-CALHM1 shifts the balance between neurodegeneration and neuronal survival, potentially contributing to its detrimental effects in Alzheimer's disease. PMID: 26416646
  3. CALHM1 polymorphism may serve as a potential biomarker in Alzheimer's disease patients (meta-analysis). PMID: 26944452
  4. The rare R154H variant impairs CALHM1's regulation of cytosolic Ca2+ and Aβ accumulation. PMID: 25386646
  5. The CALHM1 p.P86L variation may not be an Alzheimer's disease susceptibility factor in the Han Chinese population. PMID: 24630757
  6. No association was found between polymorphisms in the CALHM1 gene and mesial temporal lobe epilepsy risk in a Chinese population. PMID: 24326043
  7. Rare genetic variants in CALHM1 may lead to Ca2+ dysregulation and contribute to early-onset Alzheimer's disease risk through a mechanism independent of the amyloid cascade. PMID: 24069280
  8. This study identified a novel mechanism for controlling Ca2+-dependent ERK1/2 signaling in neurons, establishing CALHM1's critical role in neuronal signaling and function. PMID: 23345406
  9. CALHM1 is a functionally conserved ion channel with an important yet potentially toxic role in excitable cell function. PMID: 23884934
  10. Structural and functional similarities exist between the CALHM1 ion channel and connexins, pannexins, and innexins. PMID: 23300080
  11. CALHM1 is a voltage-gated ATP-release channel essential for sweet, bitter, and umami taste perception. PMID: 23467090
  12. A TGG haplotype defined by the rs4918016-rs2986017-rs2986018 block was associated with sporadic Creutzfeldt-Jakob disease. PMID: 22874670
  13. No association was detected between CALHM1 polymorphism and Alzheimer's disease risk. PMID: 21378601
  14. The CALHM1 P86L variant was associated with elevated CSF Aβ42 and Aβ40 levels in a normal cohort at risk for Alzheimer's disease. PMID: 21629967
  15. CALHM1 increases Ca2+ leak from the ER and reduces ER Ca2+ uptake by decreasing both the transport capacity and Ca2+ affinity of SERCA. PMID: 21574960
  16. The CALHM1 Pro86Leu polymorphism may influence the age of onset of Alzheimer's disease by interacting with the apolipoprotein E ε4 allele. PMID: 20847397
  17. The SNP rs11191692 in CALHM1 confers increased susceptibility to temporal lobe epilepsy. PMID: 21439911
  18. No significant difference in CALHM1 allele and genotype frequencies was observed between Alzheimer's disease patients and controls. PMID: 19545933
  19. The CALHM1 P86L variant may not influence Alzheimer's disease risk in the Japanese population. PMID: 19655363
  20. Meta-analysis of gene-disease association and gene-gene interaction. (HuGE Navigator) PMID: 20847397
  21. GOLPH2 modifies the ApoEε4-associated risk of Alzheimer's disease. PMID: 20592574
  22. Observational study and genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 20534741
  23. Observational study of gene-disease association. (HuGE Navigator) PMID: 20574532
  24. Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator) PMID: 20592574
  25. Observational study of gene-disease association. (HuGE Navigator) PMID: 20634593
  26. No association was found between eight SNPs in the CALHM1 gene and Alzheimer's disease. PMID: 20164573
  27. The CALHM1 P86L polymorphism is associated with Alzheimer's disease in the Han Chinese population. PMID: 20061624
  28. CALHM1 is a potential candidate gene for Alzheimer's disease susceptibility. PMID: 20164592
  29. No association was found between CALHM1 variation and Alzheimer's disease, suggesting genetic heterogeneity among populations. PMID: 20164602
  30. No association was found between CALHM1 P86L and altered CSF levels of Aβ42, tau, and phospho-tau. PMID: 20005921
  31. Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator) PMID: 20164573
  32. Observational study and meta-analysis of gene-disease association. (HuGE Navigator) PMID: 20164592
  33. Observational study of gene-disease association. (HuGE Navigator) PMID: 20164602
  34. Cells with the P86L mutation in the CALHM1 channel may exhibit mitochondria more vulnerable to Ca2+ overload and apoptotic stimuli. PMID: 19944073
  35. The CALHM1 P86L polymorphism is associated with Alzheimer's disease, potentially increasing amyloid-beta levels by affecting CALHM1-mediated Ca2+ permeability. PMID: 18585350
  36. [Review] CALHM1 is expressed in all brain regions and neuronal lineage cells; it primarily localizes to the endoplasmic reticulum but is also present at the plasma membrane, where it forms a novel calcium influx pathway to the cytosol. PMID: 18667147
  37. CALHM1 may be a genetic determinant of Alzheimer's disease, as a polymorphism reduces calcium permeability. PMID: 19038093
  38. No association was observed between Alzheimer's disease risk and the Pro86Leu variant in the CALHM1 gene in over 8100 subjects. PMID: 19070563
  39. No association with late-onset Alzheimer's disease risk was observed; however, a potential modest association of minor allele homozygosity (TT) with earlier age-at-onset was noted. PMID: 19191331
  40. The polymorphism does not significantly contribute to Alzheimer's disease risk in the Belgian population. PMID: 19191332
  41. CALHM1 polymorphism is not associated with late-onset Alzheimer's disease. PMID: 19472444
  42. Observational study of gene-disease association. (HuGE Navigator) PMID: 20005921
  43. Observational study of gene-disease association. (HuGE Navigator) PMID: 20061624
  44. Observational study of gene-disease association. (HuGE Navigator) PMID: 19655363
  45. Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator) PMID: 19545933
  46. Observational study of gene-disease association. (HuGE Navigator) PMID: 19472444
  47. Observational study of gene-disease association. (HuGE Navigator) PMID: 19191331
  48. Observational study of gene-disease association. (HuGE Navigator) PMID: 19191332
  49. Observational study of gene-disease association. (HuGE Navigator) PMID: 18585350
Database Links

HGNC: 23494

OMIM: 612234

KEGG: hsa:255022

STRING: 9606.ENSP00000329926

UniGene: Hs.680365

Protein Families
CALHM family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly expressed in adult brain. Detected also in retinoic acid-differentiated SH-SY5Y cells. Specifically expressed in circumvallate taste bud cells.

Q&A

What is the fundamental structure of human CALHM1 and how does it compare to other channel proteins?

When conducting structural investigations of CALHM1, researchers typically employ recombinant expression in systems like Xenopus oocytes or mammalian cell lines, followed by techniques such as cryo-electron microscopy (cryo-EM) to resolve the three-dimensional structure . The functional pore diameter is approximately 14 Å, allowing permeation of various ions (Ca²⁺, Na⁺, K⁺, Cl⁻) and small molecules like ATP . This large-pore characteristic distinguishes CALHM1 from more selective ion channels and explains its ability to mediate ATP release in contexts like taste signaling.

What regulatory mechanisms control CALHM1 channel gating and activity?

CALHM1 exhibits a unique dual regulatory mechanism controlled by both membrane voltage and extracellular calcium concentration ([Ca²⁺]o) . Under physiological conditions with [Ca²⁺]o around 1.5 mM, CALHM1 channels remain closed at resting membrane potentials but can be activated by strong depolarizations . The activation kinetics are notably slow, with time constants of approximately 3 seconds at +60 mV, followed by deactivation upon hyperpolarization with time constants around 0.2 seconds at -80 mV .

When extracellular calcium concentration is reduced, the channel's open probability increases significantly, enabling activation even at negative membrane potentials . This creates an allosteric regulatory mechanism where voltage and Ca²⁺o work together to control channel gating. Recently identified structural features, including a lipid-binding pocket that preferentially binds phospholipids over cholesterol, also appear to play important roles in stabilizing channel structure and regulating its activity . Experimentally, researchers can manipulate CALHM1 activity by altering extracellular calcium concentrations, applying specific voltage protocols, or using pharmacological agents like ruthenium red that directly block the channel pore .

What physiological roles does CALHM1 play in different tissues and cellular contexts?

CALHM1 serves several critical physiological functions across different tissues:

In the brain, CALHM1 is expressed in cortical neurons where it contributes to neuronal excitability, particularly in response to changes in extracellular calcium concentration . Neurons from CALHM1-expressing regions respond to reduced [Ca²⁺]o with enhanced conductance, increased action potential firing, and elevated intracellular calcium levels . CALHM1 has also been implicated in modulating neuronal activity and influencing amyloid-beta accumulation, with mutations in the calhm1 gene identified as a potential risk factor for early-onset Alzheimer's disease in some population groups .

In the gustatory system, CALHM1 functions as an essential ATP release channel in type II taste bud cells that sense sweet, bitter, and umami tastes . This non-synaptic neurotransmitter (ATP) release mechanism is crucial for transmitting taste information from taste receptor cells to sensory afferent nerves .

Research approaches for studying these physiological functions typically include: transgenic mouse models with CALHM1 deletion, calcium imaging techniques to monitor intracellular calcium dynamics, electrophysiological recordings to assess channel function and neuronal activity, and ATP release assays in relevant cellular contexts .

What are the most effective methods for expressing and purifying recombinant human CALHM1 for structural and functional studies?

Successfully expressing and purifying functional human CALHM1 requires careful consideration of expression systems, purification strategies, and quality control measures. For structural studies, insect cell expression systems using baculovirus vectors have proven successful for human CALHM1, as evidenced by recent cryo-EM structures . Construct design should include appropriate purification tags (typically His-tags) and consider the addition of stabilizing mutations when necessary for structural work.

The membrane extraction and purification protocol typically involves cell membrane isolation through differential centrifugation, followed by solubilization using mild detergents like n-dodecyl-β-D-maltopyranoside (DDM) or lauryl maltose neopentyl glycol (LMNG) . Subsequent purification steps generally include immobilized metal affinity chromatography and size exclusion chromatography to obtain homogeneous protein preparations.

For functional studies, researchers should consider reconstitution into lipid bilayers or nanodiscs to maintain the channel's native environment. Quality control should assess both structural integrity (through techniques like negative-stain EM) and functional properties (via liposome flux assays or electrophysiology after reconstitution). Throughout the purification process, it's critical to monitor the oligomeric state of CALHM1, as recent structural studies have confirmed its octameric assembly in humans, which differs from some non-mammalian CALHM1 channels .

How can researchers effectively investigate the lipid-binding pocket of CALHM1 and its impact on channel structure and function?

The recently identified lipid-binding pocket in CALHM1 represents a critical structural feature conserved across species that preferentially binds phospholipids over cholesterol to stabilize channel structure and regulate its activities . Investigating this feature requires an integrated approach combining computational, biochemical, and structural methods.

Computational approaches should include molecular dynamics (MD) simulations to examine how different lipids interact with the binding pocket . These simulations can reveal the dynamic behavior of bound lipids and predict how mutations might affect lipid binding and channel function. Site-directed mutagenesis of residues lining the lipid pocket provides an experimental validation of computational predictions.

Biochemical approaches might include lipidomic analysis of co-purifying lipids with native or recombinant CALHM1, as well as functional assays that assess how lipid composition affects channel activity. Structural methods, particularly high-resolution cryo-EM, can directly visualize bound lipids within the pocket .

When interpreting results, researchers should consider that the lipid binding effects may be allosteric, indirectly affecting channel gating rather than directly influencing ion permeation. The recent demonstration that this pocket preferentially binds phospholipids over cholesterol has important implications for understanding how membrane composition might regulate CALHM1 function in different cellular contexts .

What experimental approaches can address contradictory findings regarding CALHM1's role in Alzheimer's disease pathogenesis?

Mutations in the calhm1 gene have been identified as potential risk factors for early-onset Alzheimer's disease in some population groups, but findings across studies have been inconsistent . To address these contradictions, researchers should implement multi-faceted approaches that examine genetic associations, functional consequences, and disease mechanisms.

Genetic studies should be expanded to include diverse populations and employ meta-analytical approaches that account for population stratification and gene-environment interactions. For functional characterization, researchers should compare wild-type and mutant CALHM1 variants in terms of channel conductance, calcium signaling dynamics, and interactions with amyloid processing machinery.

Disease modeling using transgenic mice expressing human CALHM1 variants or patient-derived induced pluripotent stem cells differentiated into neurons can provide systems to study the effects of CALHM1 mutations in relevant cellular contexts. These models should assess multiple parameters including calcium homeostasis, amyloid-β production, and neuronal excitability.

Particular attention should be paid to how CALHM1-mediated calcium signaling might interact with other calcium-dependent processes implicated in Alzheimer's disease, including mitochondrial function, endoplasmic reticulum stress, and synaptic plasticity. The development of selective CALHM1 modulators could provide valuable tools to further probe these relationships and potentially offer therapeutic approaches for patients with CALHM1-associated risk factors .

What are the optimal electrophysiological approaches for characterizing CALHM1 channel properties?

Characterizing CALHM1's unique electrophysiological properties requires specialized approaches that account for its dual regulation by voltage and extracellular calcium. Expression systems like Xenopus oocytes have proven effective for two-electrode voltage clamp recordings, as demonstrated in initial characterization studies . For more detailed kinetic analysis, mammalian expression systems combined with patch-clamp techniques may offer superior temporal resolution.

Voltage-clamp protocols must accommodate CALHM1's distinctive kinetics. Depolarizing voltage steps should be sufficiently long (3-5 seconds) to capture the slow activation kinetics of CALHM1 (τ ~3s at +60mV) . Tail current protocols are essential for determining reversal potentials and assessing ion selectivity. When designing experiments, researchers should systematically vary both membrane voltage and extracellular calcium concentration to map the interdependent effects of these two regulatory factors.

For ion selectivity studies, ion substitution experiments combined with reversal potential measurements can determine relative permeabilities. CALHM1 channels discriminate poorly among cations and anions, with even large signaling molecules like ATP able to permeate through the pore . Pharmacological characterization should include known blockers like ruthenium red, which binds to residues in the amino-terminal helix that form the channel pore , and CGP37157, which has shown promise as a CALHM1 inhibitor .

When conducting these studies, researchers should control for endogenous conductances in their expression systems and include appropriate calcium chelators to prevent activation of calcium-activated currents that could confound CALHM1 measurements .

How can researchers distinguish between CALHM1-mediated currents and other calcium-permeable channels in native tissues?

Distinguishing CALHM1 currents from other calcium-permeable channels in native tissues presents significant challenges due to the diversity of calcium-permeable channels expressed in most cell types. An effective approach combines biophysical fingerprinting, pharmacological profiling, and genetic tools.

CALHM1 currents have several distinctive biophysical characteristics: slow activation upon depolarization (τ ~3s), enhancement by low extracellular calcium, and relatively non-selective permeability to both cations and anions . In contrast, voltage-gated calcium channels typically show faster activation kinetics and higher selectivity for calcium ions. The large pore size of CALHM1 (approximately 14 Å) also distinguishes it from most other calcium-permeable channels .

Pharmacologically, CALHM1 is sensitive to ruthenium red and CGP37157 . A differential pharmacological approach can help isolate CALHM1 currents by sequential application of blockers targeting other calcium-permeable channels (like L-type calcium channel blockers) followed by CALHM1-specific blockers.

Genetic approaches provide the most definitive tools for identifying CALHM1-mediated currents. Comparing tissues from wild-type and CALHM1-knockout animals allows unambiguous identification of CALHM1 contributions to observed currents . Similarly, siRNA-mediated knockdown can reduce CALHM1 expression and consequently its contribution to whole-cell currents.

When studying CALHM1 in brain tissues, researchers should be particularly attentive to the potential overlap with connexin hemichannels and pannexin channels, which share some properties with CALHM1 including large pore size and ATP permeability .

How does CALHM1 modulation affect outcomes in experimental models of ischemic stroke?

Recent evidence indicates that CALHM1 plays a significant role in ischemic brain injury, with its inhibition or genetic deletion conferring remarkable neuroprotection. In an oxygen and glucose deprivation followed by reoxygenation (OGD/Reox) model of ischemia using hippocampal slices, tissues from CALHM1-knockout mice (Calhm1⁻/⁻) showed significantly higher viability (72.5% ± 4) compared to wild-type (60.4% ± 2.3) . Notably, even partial deletion of CALHM1 (Calhm1⁺/⁻) provided significant protection (74.2% ± 6.2 viability compared to 58.4% ± 2.7 in wild-type) .

The neuroprotective mechanism appears to involve multiple pathways. First, absence of CALHM1 likely reduces excessive calcium influx during ischemia and reperfusion, preventing calcium-dependent cell death cascades . Additionally, CALHM1-knockout tissues show lower reactive oxygen species (ROS) production when subjected to OGD/Reox conditions, suggesting reduced oxidative stress . Interestingly, CALHM1 deletion also leads to increased expression of hypoxia-inducible factor 1-alpha (HIF-1α), which may enhance adaptive responses to hypoxia .

What is the evidence for CALHM1's involvement in glutamate excitotoxicity, and how might this inform neuroprotective strategies?

CALHM1 appears to contribute significantly to glutamate excitotoxicity, a key mechanism of neuronal injury in many neurological conditions. In experimental models, hippocampal slices from CALHM1-knockout mice (Calhm1⁻/⁻) show enhanced resistance to glutamate-induced cell death compared to wild-type tissues . When exposed to 1 mM glutamate for 4 hours, wild-type hippocampal slices showed reduced viability (59.9% ± 3.8), while slices from Calhm1⁻/⁻ mice maintained significantly higher viability (70.5% ± 6) .

The mechanistic basis for this protection likely involves prevention of excessive calcium entry through CALHM1 channels during glutamate challenge. Glutamate receptor activation causes membrane depolarization, which can activate CALHM1 channels, potentially exacerbating calcium overload beyond that mediated directly by NMDA receptors and voltage-dependent calcium channels . Additionally, glutamate-induced excitotoxicity is frequently accompanied by changes in extracellular ion concentrations that may further enhance CALHM1 activation.

The CALHM1 inhibitor CGP37157 provides significant protection against glutamate excitotoxicity in wild-type tissues but shows reduced effectiveness in CALHM1-knockout tissues . This pattern suggests that in wild-type tissues, CGP37157 provides protection both by blocking CALHM1 and potentially other calcium entry pathways, while in CALHM1-knockout tissues, only the non-CALHM1 mechanisms remain relevant.

These findings highlight the potential for CALHM1 inhibitors as neuroprotective agents in conditions involving glutamate excitotoxicity, including stroke, traumatic brain injury, and neurodegenerative diseases. Combination approaches targeting both CALHM1 and conventional glutamate receptors might provide enhanced neuroprotection by addressing multiple calcium entry pathways simultaneously .

What are the current challenges and strategies for developing specific pharmacological modulators of CALHM1?

Developing specific pharmacological modulators of CALHM1 presents significant challenges but offers therapeutic potential for conditions like ischemic stroke and neurodegenerative diseases. Current challenges include achieving selectivity over structurally similar channels and developing compounds with appropriate physicochemical properties for their intended applications.

Recent structural insights from cryo-EM studies of human CALHM1 provide valuable information for structure-based drug design approaches . Potential strategies include targeting the unique features of the CALHM1 pore or developing allosteric modulators that bind to the lipid-binding pocket identified in recent studies . The latter approach might offer greater selectivity since the lipid-binding characteristics may differ between CALHM1 and related channels.

For screening approaches, functional assays could include calcium imaging or electrophysiological methods in recombinant systems expressing CALHM1. Counter-screening against related channels (connexins, pannexins) and other calcium entry pathways would be essential to establish selectivity. Given CALHM1's role in neuroprotection against ischemia and excitotoxicity, phenotypic screening using models like OGD/Reox could identify compounds with desired functional effects regardless of their precise molecular mechanism .

How can researchers effectively investigate the relationship between CALHM1 and HIF-1α in neuroprotective mechanisms?

The relationship between CALHM1 and hypoxia-inducible factor 1-alpha (HIF-1α) represents an intriguing aspect of CALHM1-related neuroprotection. Studies have shown that CALHM1-knockout tissues exhibit increased HIF-1α expression when subjected to oxygen and glucose deprivation followed by reoxygenation . This finding suggests that CALHM1 activity may influence hypoxic adaptation pathways, with potential implications for neuroprotective strategies.

To investigate this relationship, researchers should employ complementary approaches. Comparative studies between wild-type and CALHM1-knockout tissues under normoxic and hypoxic conditions can establish the baseline differences in HIF-1α expression and activation. Temporal analyses are important to determine whether HIF-1α upregulation is an immediate consequence of CALHM1 absence or develops over time, possibly as a compensatory mechanism.

Since CALHM1 is a calcium-permeable channel, the calcium dependence of the observed effects should be examined. Pharmacological manipulation of calcium signaling in both wild-type and CALHM1-knockout tissues can help determine whether reduced calcium influx in CALHM1-knockout tissues directly contributes to HIF-1α upregulation. Conversely, HIF-1α knockdown or inhibition in CALHM1-knockout tissues would test whether enhanced HIF-1α activity is necessary for the observed neuroprotection.

Mechanistically, researchers should investigate potential intermediate signaling pathways that might connect CALHM1-mediated calcium entry to HIF-1α regulation. These could include calcium-dependent kinases, phosphatases, or redox-sensitive pathways, as HIF-1α stability is heavily influenced by oxygen-dependent hydroxylation and ubiquitination processes .

Understanding this relationship could lead to novel therapeutic strategies that target both CALHM1 inhibition and HIF-1α stabilization, potentially offering synergistic neuroprotection in conditions like ischemic stroke.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.