Recombinant Human Calcium release-activated calcium channel protein 1 (ORAI1)

Shipped with Ice Packs
In Stock

Description

Introduction to ORAI1

ORAI1 is the pore-forming subunit of the calcium release-activated calcium (CRAC) channel, a store-operated channel critical for Ca²⁺ signaling in mammalian cells . It mediates Ca²⁺ influx upon depletion of endoplasmic reticulum (ER) stores, a process regulated by the ER-resident Ca²⁺ sensor STIM1 . Structurally, ORAI1 contains four transmembrane helices (TMs), with TM1 forming the central ion-conducting pore . Functional studies reveal its role in immune responses, epithelial transport, and cancer progression .

Recombinant ORAI1 Protein

Recombinant human ORAI1 is engineered for in vitro studies to elucidate its structure, function, and interactions. Key features include:

Expression Systems and Purification

  • Escherichia coli: Used to produce truncated ORAI1 fragments (e.g., residues 1–137) with >90% purity .

  • Tobacco (Nicotiana tabacum): Utilized for full-length ORAI1 (residues 1–301) fused with Strep tags for affinity purification .

Pore Architecture

  • TM1 Central Role: Residues E106 (TM1) and E190 (TM3) are critical for Ca²⁺ selectivity. E106 forms a Ca²⁺-binding site, while E190 has an indirect role .

  • Rigid Pore Segment: Residues 99–104 in TM1 create a constriction point, influencing ion selectivity and channel gating .

STIM1 Interaction

  • STIM1 binds ORAI1’s N-terminal cytoplasmic region (residues 65–87) to activate CRAC channels .

  • Mutations (e.g., K85E) disrupt STIM1-mediated gating, highlighting the N terminus’s regulatory role .

Calcium Signaling Studies

Recombinant ORAI1 enables:

  • Electrophysiological Characterization: Measures CRAC currents under store-depleted conditions .

  • Cross-Linking Experiments: Identifies oligomeric states and pore flexibility using cysteine mutants .

Disease Models

DiseaseRole of ORAI1
Immunodeficiency 9Loss-of-function mutations impair T-cell activation and Ca²⁺ influx .
Colorectal CancerORAI1 overexpression promotes TGF-β-induced EMT via Ca²⁺-dependent calpain activation .
Tubular Aggregate MyopathyGain-of-function mutations cause muscle weakness due to excessive Ca²⁺ entry .

Drug Discovery

  • Pharmacological Inhibitors: 2-APB blocks SOCE, suppressing TGF-β-induced EMT in cancer cells .

  • CRAC Channel Modulators: Target ORAI1-STIM1 interactions for autoimmune and inflammatory diseases .

Clinical Relevance

ORAI1 mutations are linked to:

  • Immune Dysfunction: Impaired NFAT activation in T-cells and B-cells leads to recurrent infections .

  • Cancer Metastasis: Elevated ORAI1 correlates with advanced CRC stages and poor prognosis .

Table 2: Recombinant ORAI1 Expression Systems

SourceExpression HostTagApplications
MyBioSource Cell-freeNoneStructural studies, antibody production
Abcam E. coliHis-tagSDS-PAGE, mass spectrometry
Antibodies-Online TobaccoStrep-tagFunctional assays, protein interactions

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ORAI1; CRACM1; TMEM142A; Calcium release-activated calcium channel protein 1; Protein orai-1; Transmembrane protein 142A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-301
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSY SEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDADHDYPPGLL IAFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFST VIGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQAAAIAST TIMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHY A
Uniprot No.

Target Background

Function
Recombinant Human ORAI1 is a calcium release-activated calcium (CRAC) channel subunit mediating calcium influx following depletion of intracellular calcium stores. Activation is triggered by the calcium sensor STIM1. CRAC channels are the primary pathway for calcium influx in T-cells, promoting immune responses by activating the transcription factor NFAT. ORAI1 also plays a significant role in basolateral membrane calcium influx in mammary epithelial cells, independent of endoplasmic reticulum or Golgi calcium levels, potentially mediating substantial transepithelial calcium transport for milk secretion.
Gene References Into Functions
  1. ORAI1 gene SNPs rs12320939 and rs3741596 are associated with chronic spontaneous urticaria risk. PMID: 27864023
  2. STIM1 pore helix rotation demonstrates dynamic coupling between Orai1 gating and ion selectivity. PMID: 28220789
  3. Loop2 regions connecting TM2 and TM3 of Orai1 and Orai3 exhibit distinct properties influencing isoform-specific behavior of Orai N-truncation mutants. PMID: 29237733
  4. The conserved Orai N-terminus is crucial for STIM1-mediated fine-tuning of open Orai channel gating, establishing authentic CRAC channel activity. PMID: 29237734
  5. Constitutive Orai1 activation in Stormorken syndrome primarily involves the STIM1 CRAC-activating domain (CAD/SOAR), regulated by the interplay of three cytosolic STIM1 coiled-coil (CC) domains. PMID: 29483506
  6. BPIFA1 (SPLUNC1) is identified as an epithelium-derived smooth muscle relaxing factor, internalizing Orai1. BPIFA1 deficiency in asthmatic airways enhances Orai1 hyperactivity, increasing airway smooth muscle contraction and hyperresponsiveness. PMID: 28165446
  7. Each STIM1 monomer within a dimer interacts independently with single Orai1 subunits to mediate cross-linking between Orai1 channels. PMID: 29581306
  8. ORAI1 binding to STIM1 requires STIM1 Y361 phosphorylation by PYK2. PMID: 28218251
  9. Zinc inhibits esophageal cancer cell proliferation through Orai1-mediated intracellular calcium oscillations, suggesting a mechanism for zinc-induced cancer prevention. PMID: 28928244
  10. Hypoxia-induced Orai1 upregulation drives colon cancer invasiveness and angiogenesis. PMID: 29753044
  11. ARC channels are heteromeric assemblies of Orai1 and Orai3 proteins, distinct from Orai1-composed CRAC channels. PMID: 27847114
  12. Decreased Orai1 expression contributes to downregulated calcium entry during lymphocyte excitation, contributing to T lymphocyte dysfunction in diabetes. PMID: 29654766
  13. An Orai1 C-terminal STIM1-binding site triggers channel gating. PMID: 27929067
  14. Orai1 silencing reduces cell viability, induces apoptosis, and causes cell cycle arrest in multiple myeloma cell lines. PMID: 30114708
  15. Studies on the conformation and functional physiology of human ORAI1 in calcium channel gating. PMID: 29760086
  16. STIM1 and ORAI1 promote membrane ruffling, with phospho-STIM1 localizing at the leading edge and co-localizing with cortactin and ORAI1. PMID: 28341841
  17. Orai1 activation ensures random walk behavior in T cells for optimal immune surveillance. PMID: 29239723
  18. Store-operated calcium entry (SOCE) is mediated via Orai1 and other channels like TRPC1. PMID: 29594865
  19. Orai1 and miR-93 significantly impact TGF-beta1-mediated EMT and fibrogenesis in HK2 cells. PMID: 29551286
  20. Effector functions are preserved in polymorphonuclear neutrophils in patients with ORAI1 and STIM1 loss-of-function mutations. PMID: 26670474
  21. Cancer- and myopathy-related Orai1 mutations trigger calcium permeation associated with gene transcription. PMID: 29184031
  22. Functional coupling between SPCA1 and Orai1 increases cytosolic and intraluminal calcium levels, representing a novel store-independent calcium entry mechanism potentially affected in Hailey-Hailey disease. PMID: 29555205
  23. Orai1 induces aggression and angiogenesis under hypoxic conditions. PMID: 29307746
  24. ROS inhibits Orai1, identifying a potential target for pharmaceutical intervention. PMID: 27624281
  25. Orai1 binds to STIM1 and regulates cholesterol. PMID: 27459950
  26. Calcium-bound calmodulin disrupts the STIM1-Orai1 complex, deactivating store-operated calcium entry. PMID: 29051492
  27. Summary of the structure-function relationship of Orai1, its interaction with STIM1, and the chemical modulator 2-aminoethoxydiphenyl borate. PMID: 27753099
  28. Orai3 is associated with poor prognosis in lung adenocarcinoma, predicting metastasis and reduced survival. PMID: 27835593
  29. Cholesterol regulation directly affects Orai1 localization and compartmentalization. PMID: 28919480
  30. G98S and V107M mutations generate constitutively permeable ORAI1 channels, while T184M alters permeability only with STIM1. PMID: 28058752
  31. Inhibition of SOCE-dependent colon cancer cell migration through the SK3/TRPC1/Orai1 complex may modulate Anti-EGFR mAb action in metastatic colorectal cancer. PMID: 27102434
  32. Orai1 enhances cancer stemness in oral/oropharyngeal squamous cell carcinoma progression. PMID: 27259269
  33. The ORAI1 gene (rs7135617) GG genotype/G allele is a risk factor for calcium oxalate stone formation. PMID: 28845932
  34. Orai1 expression predicts 5-Fluorouracil sensitivity in hepatocarcinoma treatment. PMID: 27878958
  35. Orai1-mediated calcium influx negatively regulates the TGF-beta1/Smad3 signaling pathway in mesangial cells. PMID: 28637791
  36. F. vulgare fruit extract inhibits ORAI1 currents, tyrosinase activity, and UV-induced melanogenesis. PMID: 27712859
  37. Aptamer Y1 binds Orai1, inhibiting calcium influx in antigen-activated mast cells. PMID: 27390850
  38. Elevated Orai1 and STIM1 expressions upregulate MACC1, promoting tumor cell proliferation, metabolism, migration, and invasion in human gastric cancer. PMID: 27431311
  39. Orai1 expression is higher in colorectal cancer tissues, enhancing cell proliferation and inhibiting apoptosis via the Akt/GSK3beta pathway; Orai1 is a direct target of miR-519. PMID: 26792278
  40. The CRAC channel functions as a hexamer of Orai1 subunits. PMID: 27806271
  41. A novel ORAI1 mutation (c.290C>G, p.S97C) causes mild, late-onset tubular aggregate myopathy and congenital miosis via constitutive CRAC channel activation. PMID: 27882542
  42. Review on STIM protein activation, STIM1 coupling to Orai1, and structural rearrangements in Orai channel gating. PMID: 26825122
  43. Evidence indicates that the Orai1 channel functions as a hexamer, not a tetramer. PMID: 27780862
  44. APP does not modulate Orai-dependent store-operated calcium entry after quantitative calcium store depletion. PMID: 27526994
  45. Orai1 regulates osteogenic differentiation through BMP signaling, a potential therapeutic target for bone diseases. PMID: 27086849
  46. Orai1-mediated calcium influx and SPCA2-mediated calcium uptake into the Golgi/secretory pathway may be coupled, potentially playing a role in SPCA2-expressing secretory cells. PMID: 27692665
  47. Potential for developing ORAI1-targeting compounds to modulate autoimmune disorders. PMID: 26895524
  48. Review on STIM1 and ORAI1 gene mutations causing calcium dyshomeostasis in tubular aggregate myopathy. PMID: 27879676
  49. Orai1-mediated calcium entry is critical for gastrointestinal stromal tumor cell proliferation via c-KIT and ERK signaling pathway activation. PMID: 28231736
  50. SARAF overexpression attenuates store-operated calcium entry and STIM1-Orai1 interaction, while SARAF silencing induces opposite effects. PMID: 27068144
Database Links

HGNC: 25896

OMIM: 610277

KEGG: hsa:84876

STRING: 9606.ENSP00000328216

UniGene: Hs.55148

Involvement In Disease
Immunodeficiency 9 (IMD9); Myopathy, tubular aggregate, 2 (TAM2)
Protein Families
Orai family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in naive CD4 and CD8 T cells (at protein level). Expressed at similar levels in naive and effector T helper cells.

Q&A

What is ORAI1 and what is its primary function in cellular physiology?

ORAI1 is a plasma membrane protein that forms the pore of calcium release-activated calcium (CRAC) channels. Its primary function is mediating store-operated calcium entry (SOCE), a process initiated when intracellular calcium stores in the endoplasmic reticulum are depleted. ORAI1 interacts with stromal interaction molecule 1 (STIM1), an ER calcium sensor, to facilitate calcium influx from the extracellular space.

The ORAI1 protein exists in multiple isoforms, with the full-length ORAI1 (starting at methionine-1) and a shorter ORAI1β isoform (starting at methionine-64) being the most well-characterized . These isoforms can be resolved as two distinct bands in western blots after deglycosylation with PNGase F, indicating post-translational modifications that affect their molecular weight .

How can researchers differentiate between ORAI1 isoforms in experimental settings?

Researchers can differentiate between ORAI1 isoforms through several approaches:

  • Western blotting with deglycosylation: Treat protein samples with PNGase F to remove glycosylation, allowing resolution of the different isoforms by molecular weight .

  • Genetic engineering: Use CRISPR/Cas9 technology to generate ORAI1-knockout cell lines (such as ORAI1-KO HEK293 cells), providing a clean background for expression of individual isoforms .

  • Expression constructs: Engineer constructs that exclusively express either ORAI1 or ORAI1β by manipulating translation start sites, often with fluorescent tags like CFP for detection .

  • Functional characterization: Measure calcium-dependent inactivation (CDI) using patch-clamp electrophysiology, as ORAI1 displays robust CDI compared to ORAI1β when using voltage-step protocols with 10 mM EGTA in the patch pipette .

What techniques are commonly used for studying ORAI1 expression and function?

Several methodological approaches are employed to study ORAI1:

  • Gene manipulation techniques:

    • CRISPR/Cas9 gene editing for complete knockout of ORAI1

    • Lentiviral shRNA knockdown for reduced expression

    • Transient or stable transfection with ORAI1 constructs

  • Calcium imaging and electrophysiology:

    • Patch-clamp recordings to measure CRAC currents

    • Calcium imaging to monitor intracellular calcium dynamics

    • Specific protocols to measure calcium-dependent inactivation (CDI)

  • Protein detection methods:

    • Western blotting with deglycosylation to distinguish isoforms

    • Immunofluorescence for localization studies

    • Co-immunoprecipitation to identify protein interactions

  • Advanced microscopy:

    • Light and electron microscopy (LPEM) to map positions of individual ORAI1 proteins

    • Quantum dot (QD) labeling to visualize ORAI1 distribution in cells

How does ORAI1 clustering affect its function in calcium signaling?

ORAI1 proteins form distinct supra-molecular clusters even at rest, which plays a crucial role in calcium signaling. Research using light and electron microscopy (LPEM) has revealed important insights into these structures:

ORAI1 clustering exhibits specific spatial organization patterns beyond random distribution. In resting cells, ORAI1 forms elongated clusters containing multiple ORAI1 hexamers. These clusters are approximately 19% longer and have a 24% larger aspect ratio compared to simulations of randomly distributed hexameric ORAI1 channels .

Analysis of ORAI1 distribution in cells with varying expression levels shows that:

Experimental ConditionNumber of CellsNumber of LabelsLabel Density/μm²Analyzed Area (μm²)
ORAI-HA at rest14157,7291571007
ORAI-HA activated by 15 min Tg (with 1:1 STIM1 co-expression)15245,1181551584
ORAI-HA activated by 15 min Tg (with 1:3 STIM1 co-expression)21370,9461622292

The clustering pattern appears to be organized rather than random, suggesting a functional significance for these supra-molecular arrangements . The methodological approach for studying these clusters includes:

  • Quantum dot (QD) labeling of ORAI1 with approximately 30% labeling efficiency

  • Scanning transmission electron microscopy (STEM) imaging of whole cells

  • Analysis of cluster properties in cells with varying expression levels

  • Comparison with simulated random distributions to identify non-random clustering patterns

These pre-formed ORAI1 clusters likely serve as amplification sites for creating dense ORAI1 accumulations when SOCE is activated .

What is the role of ORAI1 in cancer cell proliferation and tumor growth?

ORAI1 plays a critical role in regulating cancer cell proliferation and tumor growth, particularly in oral cancer. Several experimental approaches have demonstrated this relationship:

  • ORAI1 knockdown effects on calcium signaling:

    • Lentiviral shRNA knockdown of ORAI1 (shORAI1) in HSC-3 oral cancer cells reduces store-operated calcium entry (SOCE) by approximately 70% .

    • Complete CRISPR/Cas9 deletion of ORAI1 in HSC-3 cells abolishes SOCE entirely, demonstrating ORAI1's essential role in mediating calcium influx in oral cancer cells .

  • Impact on cancer cell proliferation:

    • Both pharmacological inhibition (using synta-66) and genetic knockdown/deletion of ORAI1 significantly decrease cancer cell proliferation in vitro .

    • Importantly, while ORAI1 deletion reduces proliferation, it does not induce cell death, suggesting a specific role in growth regulation rather than survival .

  • In vivo tumor growth:

    • In mouse models, paw volume in animals injected with shORAI1 HSC-3 cells showed significantly reduced growth compared to control HSC-3 cells .

    • Histological analysis (H&E staining) confirmed decreased tumor size in tissues inoculated with ORAI1-knockdown cells .

    • ORAI1 knockdown also resulted in downregulation of MMP1 expression in tumor tissues, suggesting a mechanistic link between ORAI1 and matrix metalloproteinases in cancer progression .

These findings highlight ORAI1 as a potential therapeutic target in oral cancer, with both in vitro and in vivo evidence supporting its role in tumor growth regulation.

How does ORAI1 contribute to immune cell function and autoimmune disorders?

ORAI1 plays a crucial role in immune cell function, particularly in T cells, and has been implicated in autoimmune disorders. Research using genetic and pharmacological approaches has revealed:

  • ORAI1 in experimental autoimmune encephalomyelitis (EAE):

    • Mice lacking ORAI1 specifically in T cells show attenuated severity of EAE (a model of multiple sclerosis) when immunized with MOG peptide .

    • The infiltration of T cells and innate immune cells into the central nervous system (CNS) is strongly reduced in ORAI1-deficient animals .

    • Production of pro-inflammatory cytokines IL-17A, IFN-γ, and GM-CSF is almost completely abolished despite only partially reduced calcium influx .

  • Differential effects on T cell subsets:

    • In vitro differentiated Th1 and Th17 cells require ORAI1 for cytokine production .

    • Interestingly, ORAI1 is not required for the expression of subset-defining transcription factors T-bet (Th1) and RORγt (Th17) .

    • The differentiation and function of induced regulatory T cells (iTregs) is independent of ORAI1, suggesting selective involvement in pro-inflammatory but not regulatory T cell function .

These findings suggest that ORAI1 inhibition could be a potential therapeutic strategy for autoimmune diseases, particularly those mediated by Th1 and Th17 responses, while potentially preserving regulatory T cell function.

What mechanisms underlie ORAI1 channel inactivation and how do they affect calcium signaling?

ORAI1 channels undergo calcium-dependent inactivation (CDI), which serves as a critical regulatory mechanism for calcium signaling. Research has uncovered several important aspects of this process:

Understanding these mechanisms is crucial for developing targeted approaches to modulate calcium signaling in various physiological and pathological contexts.

How can researchers effectively modulate ORAI1 function for experimental purposes?

Researchers can modulate ORAI1 function through several technical approaches:

  • Genetic modification strategies:

    • CRISPR/Cas9 gene editing: Complete deletion of ORAI1 provides a clean background for studying calcium signaling. This approach has been successfully used in cell lines like HEK293 to abolish SOCE .

    • shRNA knockdown: Lentiviral delivery of ORAI1-targeted shRNA (shORAI1) can reduce ORAI1 expression by approximately 70%, providing a model of partial ORAI1 inhibition .

    • Conditional knockout: Inducible genetic deletion systems allow for temporal control of ORAI1 expression, useful for studying developmental effects .

  • Expression system approaches:

    • Promoter control: Expression of ORAI1 constructs under different promoters (e.g., strong CMV vs. weak thymidine kinase promoter) allows for titration of expression levels .

    • Isoform-specific expression: Engineering constructs to exclusively express either ORAI1 or ORAI1β enables comparative functional studies .

    • Fusion proteins: C-terminal tagging with fluorescent proteins (CFP, YFP) facilitates visualization while maintaining function .

  • Pharmacological modulation:

    • ORAI inhibitors: Compounds like synta-66 can block SOCE and provide acute inhibition of ORAI1 function .

    • Selective targeting: Development of isoform-selective inhibitors represents an emerging approach for more precise modulation.

  • Mutational analysis:

    • Structure-function studies: Site-directed mutagenesis of key residues (e.g., R31-33A, Y52A, W55A) can dissect molecular mechanisms of ORAI1 function .

    • Chimeric constructs: Exchange of domains between ORAI1 and ORAI1β can identify regions responsible for functional differences.

Each approach offers distinct advantages depending on the research question, with genetic methods providing specificity and pharmacological approaches offering temporal control.

What are the optimal approaches for visualizing ORAI1 distribution and dynamics in cells?

Visualizing ORAI1 distribution and dynamics requires specialized techniques due to the complex arrangement of these channels. Several methodological approaches have proven effective:

  • Light and electron microscopy (LPEM) combined approach:

    • Quantum dot (QD) labeling of HA-tagged ORAI1 provides specific detection with high signal-to-noise ratio .

    • Scanning transmission electron microscopy (STEM) enables high-resolution mapping of individual ORAI1 positions .

    • Selection of cells based on QD fluorescence intensities allows categorization into low, medium, or high ORAI1 expression levels .

  • Quantitative analysis considerations:

    • Label density measurements: Typical densities range from 74/μm² (low expressing cells) to 274/μm² (high expressing cells) .

    • Cluster analysis: Specialized algorithms can identify and characterize ORAI1 clusters, measuring parameters such as length and aspect ratio .

    • Comparison with simulated random distributions: This approach helps distinguish between random and organized ORAI1 arrangements .

  • Technical limitations and solutions:

    • Incomplete labeling: Labeling efficiency of approximately 30% for QD-labeled ORAI1 means some proteins remain undetected; statistical corrections can account for this .

    • Cluster boundary determination: Analysis of low-expressing cells improves accuracy by reducing the frequency of touching cluster boundaries .

    • Sample preparation: Careful whole-cell preparation preserves native membrane architecture for more accurate ORAI1 distribution assessment.

These methods have revealed that ORAI1 forms distinct supra-molecular clusters even at rest, with elongated shapes that appear to follow an underlying organization rather than random distribution .

How can researchers accurately measure ORAI1-mediated calcium currents?

Accurate measurement of ORAI1-mediated calcium currents requires specialized electrophysiological approaches:

  • Patch-clamp electrophysiology protocols:

    • Whole-cell configuration with 10 mM EGTA in the patch pipette facilitates measurement of calcium release-activated calcium (CRAC) currents .

    • Voltage-step protocols are particularly useful for assessing calcium-dependent inactivation (CDI) properties of ORAI1 channels .

    • Comparison of currents at different time points (e.g., remaining current at 146 ms) provides quantitative assessment of inactivation kinetics .

  • Expression system considerations:

    • Co-expression of ORAI1 with STIM1 is typically necessary to observe robust CRAC currents .

    • Controlled expression levels using different promoter strengths (e.g., CMV vs. thymidine kinase) allows for physiological vs. overexpression studies .

    • ORAI1-knockout cell backgrounds provide clean systems for studying specific ORAI1 variants without interference from endogenous channels .

  • Analytical parameters:

    • Time constants of inactivation: Calculate fast and slow components of current decay to characterize inactivation kinetics .

    • Current-voltage relationships: Assess the characteristic inward rectification of ORAI1-mediated currents.

    • Pharmacological sensitivity: Confirm ORAI1 specificity using inhibitors like synta-66 .

These approaches enable detailed characterization of ORAI1 function in various experimental contexts, providing insights into its physiological and pathological roles.

What experimental models are most suitable for studying ORAI1 in cancer and immune disorders?

Several experimental models have proven valuable for studying ORAI1's role in cancer and immune disorders:

  • Cancer research models:

    • Cell lines: HSC-3 and SCC-9 oral cancer cells provide robust systems for studying ORAI1 in cancer progression .

    • Mouse xenograft models: Injection of human cancer cells (with or without ORAI1 knockdown) into athymic nude mice enables assessment of tumor growth in vivo .

    • Paw volume measurement and H&E staining of tissue sections offer quantitative and qualitative assessment of tumor growth, respectively .

  • Immune disorder models:

    • Experimental autoimmune encephalomyelitis (EAE): This mouse model of multiple sclerosis allows investigation of ORAI1's role in T cell-mediated autoimmunity .

    • T cell-specific ORAI1 knockout mice: Selective deletion of ORAI1 in T cells helps distinguish T cell-intrinsic effects from those in other cell types .

    • In vitro T cell differentiation systems: These enable study of ORAI1's role in different T cell subsets (Th1, Th17, iTreg) under controlled conditions .

  • Methodological considerations:

    • For cancer studies: Combining proliferation assays (e.g., MTS), gene expression analysis, and in vivo models provides comprehensive assessment of ORAI1's role .

    • For immune studies: Analysis of cytokine production, transcription factor expression, and disease progression in animal models offers insights into ORAI1's immunoregulatory functions .

    • Temporal considerations: Inducible genetic systems allow for investigation of acute vs. developmental effects of ORAI1 deficiency .

These models provide complementary insights into ORAI1's diverse physiological and pathological roles and can be selected based on specific research questions.

How does ORAI1 contribute to pain signaling pathways in cancer?

Recent research has uncovered an important role for ORAI1 in pain signaling pathways associated with cancer:

  • Regulation of nociceptive mediator release:

    • ORAI1 regulates the release of nociceptive mediators from oral cancer cells that can activate and sensitize trigeminal ganglion (TG) neurons .

    • Calcium responses in isolated murine TG neurons are significantly decreased when exposed to supernatant from ORAI1-knockout cancer cells compared to wild-type cells .

  • MMP1 as a key mediator in the ORAI1-pain pathway:

    • Matrix metalloproteinase-1 (MMP1) has been identified as a secreted factor involved in pain transmission whose release is regulated by ORAI1 .

    • ORAI1 controls both transcription and translation of MMP1 in oral cancer cells .

    • Direct application of activated MMP1 peptide increases action potential firing frequency and reduces rheobase in cultured TG neurons, indicating increased neuronal excitability .

  • Potential mechanisms and therapeutic implications:

    • MMP1-induced modulation of neuronal excitability could be mediated by changes in voltage-gated ion channels including T-type (Cav3) calcium and tetrodotoxin-sensitive (TTX-S) and tetrodotoxin-resistant (TTX-R) sodium channels .

    • ORAI1 may regulate MMP1 release in an NFAT-dependent manner, suggesting a calcium-transcription coupling mechanism .

    • These findings suggest ORAI1 inhibition could potentially address both tumor growth and cancer-associated pain, representing a dual therapeutic approach .

This research highlights a previously underappreciated connection between calcium signaling, metalloproteinases, and pain, opening new avenues for understanding and potentially treating cancer-associated pain.

What are the latest methodological advances in manipulating ORAI1 for therapeutic applications?

Recent methodological advances have expanded our toolkit for manipulating ORAI1, with potential therapeutic applications:

  • Genetic manipulation approaches:

    • CRISPR/Cas9 technologies have enabled precise editing of ORAI1 in both research and potential therapeutic contexts .

    • Conditional and tissue-specific knockout systems provide temporal and spatial control of ORAI1 expression, allowing for targeted modulation in specific cell types .

    • AAV-based delivery systems offer potential for in vivo ORAI1 modulation in specific tissues.

  • Pharmacological targeting strategies:

    • Isoform-selective inhibitors: Development of compounds that selectively target specific ORAI1 isoforms could provide more precise modulation with fewer side effects.

    • Structure-based drug design: Improved understanding of ORAI1's three-dimensional structure has enabled more rational design of inhibitors.

    • Combination approaches: Targeting ORAI1 alongside complementary pathways (e.g., NFAT signaling) may provide synergistic effects in disease contexts.

  • Selective modulation in disease contexts:

    • In autoimmune disorders: Targeting ORAI1 selectively affects pro-inflammatory Th1 and Th17 cells while sparing regulatory T cells, potentially providing therapeutic benefit without global immunosuppression .

    • In cancer: Dual targeting of tumor growth and pain pathways through ORAI1 inhibition represents a novel therapeutic strategy .

These advances are moving ORAI1 from a basic research target to a potential therapeutic intervention point in various diseases, with methodologies increasingly focusing on selective modulation rather than complete inhibition.

What are the key unresolved questions in ORAI1 research?

Despite significant advances in understanding ORAI1 biology, several important questions remain unresolved:

  • Structural and functional relationships:

    • How do supra-molecular ORAI1 clusters precisely assemble and contribute to calcium signaling dynamics?

    • What is the complete structural basis for the differential inactivation properties of ORAI1 isoforms?

    • How does ORAI1 interact with other calcium channels and transporters to regulate cellular calcium homeostasis?

  • Disease mechanisms:

    • What determines the tissue-specific consequences of ORAI1 dysfunction in different pathological contexts?

    • How does ORAI1-mediated calcium signaling interact with other signaling pathways in complex disease states?

    • What is the precise role of ORAI1 in neuroinflammatory processes and pain signaling beyond cancer contexts?

  • Therapeutic potential:

    • Can ORAI1 modulation provide therapeutic benefit without disrupting essential physiological functions?

    • What are the optimal strategies for targeting specific ORAI1 isoforms or functions in different disease contexts?

    • How can genetic or pharmacological approaches to ORAI1 modulation be optimized for clinical translation?

These questions represent important areas for future research, with implications for both basic understanding of calcium signaling and potential therapeutic applications.

How might interdisciplinary approaches advance ORAI1 research?

Advancing ORAI1 research will likely require interdisciplinary approaches that integrate multiple technical and conceptual frameworks:

  • Integration of structural and functional methodologies:

    • Combining high-resolution structural techniques (cryo-EM, X-ray crystallography) with functional approaches (patch-clamp, calcium imaging) can provide deeper insights into structure-function relationships.

    • Advanced microscopy methods like LPEM that bridge light and electron microscopy offer unique perspectives on ORAI1 organization and dynamics .

  • Systems biology approaches:

    • Network analysis of ORAI1 interactors and downstream effectors can reveal emergent properties not apparent from reductionist approaches.

    • Multi-omics integration (transcriptomics, proteomics, metabolomics) may uncover broader consequences of ORAI1 modulation.

    • Computational modeling of calcium dynamics can help predict complex cellular responses to ORAI1 manipulation.

  • Translational research integration:

    • Bridging basic research findings with clinical observations through appropriate disease models.

    • Development of biomarkers for ORAI1 activity or dysfunction to guide potential therapeutic interventions.

    • Collaborative efforts between basic scientists, clinicians, and industry partners to advance promising therapeutic approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.