Recombinant Human Calcium uniporter protein, mitochondrial (MCU)

Shipped with Ice Packs
In Stock

Description

Definition and Core Characteristics of Recombinant Human Mitochondrial Calcium Uniporter (MCU)

Recombinant Human Mitochondrial Calcium Uniporter (MCU) is a genetically engineered protein expressed in heterologous systems (e.g., E. coli, insect cells) to study its structure, function, and regulation. MCU is the pore-forming subunit of the mitochondrial calcium uniporter complex (uniplex), mediating calcium influx into mitochondria under high cytosolic calcium conditions .

Functional Role and Regulation in Mitochondrial Calcium Homeostasis

MCU operates as part of the uniplex complex, which includes:

  • EMRE: Essential MCU Regulator (1:1 stoichiometry with MCU) .

  • MICU1/2: Calcium-sensing regulators that gate MCU activity .

  • MCUb: Dominant-negative paralog suppressing channel activity .

Regulatory Mechanisms:

RegulatorRoleExperimental EvidenceReference
MICU1Binds calcium via EF-hand domains; inhibits MCU at low [Ca²⁺] .Dominant-negative effect in MICU1 knockdowns .
MICU2Forms heterodimers with MICU1; modulates gating cooperativity .MICU2 overexpression rescues MICU1 depletion .
MCUbCompetes with MCU for oligomerization; reduces channel activity .Co-expression with MCU abrogates calcium uptake .
Ca²⁺Directly binds MICU1/2; triggers conformational changes in the uniplex .Cryo-EM structures show Ca²⁺-dependent assembly shifts .

Research Applications and Functional Assays

Recombinant MCU is critical for studying mitochondrial calcium dynamics and disease mechanisms:

Experimental Models:

ModelUse CaseKey FindingsReference
Planar Lipid BilayersDirect measurement of MCU conductance and gating kinetics .MCUb reduces channel activity by 80% .
HeLa Cell ModelsStable MCU knockdowns to test rescue by recombinant variants .NTD deletion mutants fail to restore uptake .
Cryo-EMStructural determination of uniplex assemblies in Ca²⁺-free and bound states .MICU1-MICU2 dimerization shifts gating .

Clinical and Pathological Relevance

MCU dysregulation is implicated in:

Disease Associations and Therapeutic Targets:

ConditionMechanismReference
CancerMCU overexpression promotes mitochondrial calcium buffering, supporting proliferation .
Ischemia-ReperfusionMCU-driven calcium overload triggers mitochondrial permeability transition .
DiabetesMCU regulates pancreatic beta-cell insulin secretion via calcium coupling .

Tissue-Specific Expression and Stoichiometry

Quantitative studies reveal tissue-dependent MCU:EMRE ratios:

TissueMCU:EMRE RatioFunctional ImplicationReference
Liver1:1High-capacity calcium uptake for metabolic regulation
Brain1:0.5Suggests alternative regulators or subcomplexes
Skeletal Muscle1:0.8Linked to myofiber calcium signaling and size .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we can prioritize the development of a specified tag if provided.
Synonyms
MCU; C10orf42; CCDC109A; Calcium uniporter protein, mitochondrial; HsMCU; Coiled-coil domain-containing protein 109A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
51-351
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
MCU
Target Protein Sequence
VHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTTLVLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVHLPLRQIGEKD
Uniprot No.

Target Background

Function
The mitochondrial calcium uniporter (MCU) is a protein complex that mediates calcium uptake into mitochondria. MCU constitutes the pore-forming and calcium-conducting subunit of the uniporter complex (uniplex). Its activity is regulated by MICU1 and MICU2. At low Ca²⁺ levels, MICU1 and MICU2 downregulate MCU activity; at higher Ca²⁺ levels, MICU1 enhances MCU activity. Mitochondrial calcium homeostasis is crucial for cellular physiology, regulating cell bioenergetics, cytoplasmic calcium signals, and cell death pathways. MCU plays key roles in buffering systolic calcium rises in cardiomyocytes, regulating short-term mitochondrial calcium loading during acute stress (e.g., 'fight-or-flight' response), and participating in mitochondrial permeability transition during ischemia-reperfusion injury. It also regulates glucose-dependent insulin secretion in pancreatic β-cells and influences muscle size in adults. Additionally, MCU is involved in synaptic vesicle endocytosis kinetics in central nerve terminals and antigen processing and presentation.
Gene References Into Functions
  1. MICU1 enables the mitochondrial uniporter to differentiate between Ca²⁺ and Mn²⁺. PMID: 30082385
  2. Protein arginine methyltransferase 1 (PRMT1) asymmetrically methylates MICU1, controlling mitochondrial Ca²⁺ uptake by decreasing Ca²⁺ sensitivity. UCP2/3 normalize Ca²⁺ sensitivity of methylated MICU1, restoring mitochondrial Ca²⁺ uptake. PMID: 27642082
  3. VDAC1 facilitates Ca²⁺ access to MCU, enabling Ca²⁺ transport to the matrix and from the intermembrane space to the cytosol. Intra-mitochondrial Ca²⁺ modulates TCA cycle and fatty acid oxidation enzymes. PMID: 29594867
  4. MICU2 restricts crosstalk between InsP3R and MCU channels by regulating the threshold and gain of MICU1-mediated MCU inhibition and activation. PMID: 29241542
  5. Uniporter subunit assembly is dynamically regulated for proper mitochondrial responses to intracellular Ca²⁺ signals. PMID: 28396416
  6. Weight loss via bariatric surgery restores MCU expression in visceral adipose tissue. Altered mitochondrial calcium flux in fat cells may contribute to obesity and diabetes. PMID: 28790027
  7. The mitochondrial calcium uniporter plays a role in hyperglycemia-induced endothelial cell dysfunction. PMID: 28777009
  8. Mitochondrial calcium uniporter and related proteins are potential targets for counteracting age-related muscle loss. PMID: 28039397
  9. Decreased MCU expression in hypertensive cells with mutations contributes to dysregulated mitochondrial Ca²⁺ uptake. PMID: 27471128
  10. Review of MCU complex structure, regulation, and pathophysiological roles, particularly in striated muscle. PMID: 26968367
  11. High MCU expression is associated with metastasis in hepatocellular carcinoma. PMID: 28650465
  12. EMRE's MCU-activating function is mediated by transmembrane helix interactions between both proteins. PMID: 27099988
  13. MCU may be a therapeutic target for pulmonary fibrosis due to its role in regulating mitochondrial Ca²⁺. PMID: 28351840
  14. MCU downregulation reduces tumor growth and metastasis in triple-negative breast cancer by blunting mitochondrial reactive oxygen species (mROS) production and HIF-1α expression. PMID: 27138568
  15. Cys-97 plays a role in mitochondrial ROS sensing and regulation of MCU activity. PMID: 28262504
  16. Inhibition of the mitochondrial calcium uniporter can protect neurocytes from ischemia/reperfusion injury by inhibiting excessive mitophagy. PMID: 27288019
  17. Details on MICU1 regulation of MCU/EMRE and an approach to investigate MCU/EMRE activation in intact cells. PMID: 26489515
  18. MCU's N-terminal domain is essential for modulating its function without affecting uniplex formation. PMID: 26341627
  19. The MCU-VDAC1 complex regulates mitochondrial Ca²⁺ uptake and oxidative stress-induced apoptosis. PMID: 25753332
  20. Loss of heterozygosity of the MCU gene on chromosome 10q is associated with pancreatic cancer. PMID: 25824785
  21. Evidence for the mitochondrial calcium uniporter for calcium transport. PMID: 25999421
  22. MCU encodes the pore-forming subunit of the uniporter channel. PMID: 23755363
  23. MCU regulates breast cancer cell migration via store-operated Ca²⁺ entry. PMID: 25640838
  24. Review of the biochemical identities and structures of proteins involved in mitochondrial Ca²⁺ uptake and their implications in various physiological contexts. PMID: 24366263
  25. ERp57 regulates MCU expression and mitochondrial calcium uptake. PMID: 24815697
  26. MCU overexpression is observed in some breast cancers and may provide a survival advantage. PMID: 23602897
  27. Review of the mitochondrial calcium uniporter (MCU): molecular identity and physiological roles. PMID: 23400777
  28. MICU1 and MCU's crucial roles in mitochondrial Ca²⁺ uptake in pancreatic β-cells and their involvement in sustained insulin secretion. PMID: 22904319
  29. Functional characterization of MCU protein; essential for mitochondrial calcium uptake. PMID: 21685888
  30. MCU is an oligomeric protein in the mitochondrial inner membrane that interacts with MICU1 and is necessary for mitochondrial calcium uniport. PMID: 21685886
  31. CCDC109A is a mitochondrial protein broadly expressed in mouse tissues; confirmed in humans. PMID: 18614015
Database Links

HGNC: 23526

OMIM: 614197

KEGG: hsa:90550

STRING: 9606.ENSP00000362144

UniGene: Hs.591366

Protein Families
MCU (TC 1.A.77) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the mitochondrial calcium uniporter (MCU) and what is its primary function?

The mitochondrial calcium uniporter (MCU) is a highly selective calcium ion channel located in the inner mitochondrial membrane that mediates electrophoretic calcium uptake into the mitochondrial matrix. MCU plays critical roles in cell survival and aerobic metabolism in eukaryotes by regulating mitochondrial calcium homeostasis .

Functionally, MCU:

  • Matches energetic supply with cellular demand

  • Stimulates ATP synthesis (moderate calcium elevations can double ATP synthesis rates)

  • Buffers cytosolic calcium elevations

  • Regulates spatial and temporal dynamics of intracellular calcium signaling

Experimental evidence confirms that MCU is necessary and sufficient for mitochondrial calcium uptake, with its overexpression significantly increasing mitochondrial calcium transients while its silencing dampens these responses .

What is the structure and composition of the MCU complex?

The MCU functions as part of a heteromeric protein complex of approximately 450-800 kDa. The core structure consists of:

  • MCU core channel: Forms a tetramer that creates the central calcium-conducting pore (approximately 31 kDa in humans and 34 kDa in mice)

  • EMRE (Essential MCU Regulator): Associates with MCU in a ratio that varies by tissue type and is required for function in metazoan MCU complexes

  • Regulatory components:

    • MICU1 and MICU2: EF-hand proteins that function as gate-keepers by sensing cytosolic calcium concentration

    • MCUR1: Another regulator of MCU function

The complete complex (uniplex) consists of MCU, EMRE, MICU1, and MICU2. Cryo-EM structures have revealed that in the presence of calcium, the MCU-EMRE channel remains unblocked, while in the absence of calcium, MICU1-MICU2 dimers block the channel .

How can I express and purify recombinant MCU for structural studies?

For successful expression and purification of recombinant MCU:

Expression system protocol:

  • Co-express MCU and EMRE in HEK293 cells to form the MCU-EMRE subcomplex

  • For MICU1 and MICU2, express individually in E. coli

  • Purify the MCU-EMRE subcomplex in detergent followed by reconstitution into lipid nanodisc

  • Combine the MCU-EMRE subcomplex with purified MICU1 and MICU2 to form the complete uniplex

Purification method:

  • Use size exclusion chromatography (SEC) to isolate the uniplex

  • For calcium-bound or calcium-free states, include either 2 mM calcium or 2 mM EGTA without calcium in the final SEC purification buffer

This approach has been successfully used for cryo-EM structural studies of the human mitochondrial calcium uniporter holocomplex.

What methods are available for measuring MCU activity?

Several complementary approaches have been established to measure MCU activity:

Whole-mitoplast voltage-clamping technique:

  • Allows direct measurement of MCU channel activity (IMCU)

  • Employ a ramping protocol from -160 mV to 80 mV

  • Analyze current density and current-time integral

Calcium uptake assays:

  • Isolate mitochondria from tissues or cells of interest

  • Measure calcium uptake using calcium-sensitive fluorescent dyes

  • Confirm MCU-specific uptake using the inhibitor Ruthenium Red or Ru360

Cellular calcium imaging:

  • Express genetically encoded calcium indicators targeted to mitochondria

  • Stimulate cells with agonists that increase cytosolic calcium

  • Measure the resulting mitochondrial calcium transients

These methods have been instrumental in characterizing MCU function across different tissues and experimental conditions.

What is the stoichiometry of MCU and EMRE in different tissues, and how does it affect function?

The stoichiometry between MCU and EMRE varies significantly between different tissues, challenging the previously assumed fixed 1:1 ratio. Quantitative analysis using characterized antibodies and standard proteins revealed:

TissueMCU:EMRE RatioPredominant Complex Configuration
BrainHigher than 1:1Majority of MCU tetramers bind to 2 EMREs
LiverHigher than 1:1MCU tetramers primarily bind to 1 EMRE
KidneyHigher than 1:1Almost half of MCU tetramers bound to no EMRE
HeartHigher than 1:1Almost half of MCU tetramers bound to no EMRE

Statistical calculations suggest that while a MCU tetramer binding to 4 EMREs may exist, it appears at relatively low levels in the mitochondrial inner membrane .

Methodological approach for determining stoichiometry:

  • Isolate mitochondria from different mouse tissues

  • Quantify MCU and EMRE protein levels using characterized antibodies and standard proteins

  • Calculate the molar ratios between MCU and EMRE

  • Develop statistical models to propose the stoichiometric configuration of the complex

These findings suggest a novel stoichiometric model of the MCU-EMRE complex that varies by tissue type, which may reflect tissue-specific requirements for calcium uptake and regulation.

How does calcium regulate the gating mechanism of the MCU complex?

The gating of MCU is a calcium-dependent process mediated primarily through the MICU1 and MICU2 regulatory proteins. Recent structural and functional analyses have revealed:

  • Calcium-free state:

    • MICU1 and MICU2 form heterodimers that block the MCU pore

    • This prevents calcium uptake at low cytosolic calcium concentrations

  • Calcium-bound state:

    • Calcium binding to the EF-hands of MICU1 and MICU2 induces a conformational change

    • This changes the dimerization interaction between MICU1 and MICU2

    • The MICU1-MICU2 subcomplex detaches from the pore, allowing calcium flow

The gating mechanism involves specific interactions:

  • MICU1 (but not MICU2) interacts with the MCU pore

  • This interaction is mediated by EMRE through electrostatic interactions between positively charged residues at the N-terminus of MICU1 and the C-terminal poly-aspartate tail of EMRE

  • MICU1 also makes direct interaction with the aspartate ring (D-ring) of MCU formed by the canonical DIME motif in the selectivity filter

Current models suggest that MCU becomes disinhibited only when cytosolic calcium approaches the micromolar range, resulting from cooperative calcium binding to the EF-hands of MICU1 and MICU2 .

What are the tissue-specific roles of MCU, and how do they relate to disease states?

MCU functions differ across tissues, with particularly notable roles in the heart, brain, and metabolically active organs:

Cardiac tissue:

  • MCU matches energetic demand during increased workload

  • Knockout models show protection against ischemia-reperfusion injury by preventing mitochondrial calcium overload

  • MCU stabilization during electron transport chain impairment prolongs survival in mitochondrial cardiomyopathies

Brain tissue:

  • Higher MCU:EMRE ratio compared to other tissues

  • Critical for neuronal calcium buffering and signaling

  • May be involved in neurodegenerative conditions

Metabolic tissues:

  • Recent studies have identified MCU gene polymorphisms associated with obesity

  • MCU activity affects mitochondrial metabolism and energy production

Methodological approach for studying tissue-specific functions:

  • Generate tissue-specific conditional knockout models

  • Utilize dominant-negative MCU constructs (e.g., DIME→QIMQ mutations)

  • Apply physiological and pathological stressors to assess functional outcomes

  • Measure mitochondrial calcium uptake, membrane potential, ATP production, and tissue function

Interestingly, knockout studies reveal that MCU may be dispensable for homeostatic cardiac function but required to modulate calcium-dependent metabolism during stress conditions .

How do MCU knockout models inform our understanding of MCU physiology?

Multiple MCU knockout models have provided critical insights into MCU physiology with some apparently contradictory findings that require careful interpretation:

Global knockout models:

  • First gene-trap MCU knockout was embryonically lethal on C57BL/6 background but viable when outcrossed to CD1

  • Surviving knockout mice showed:

    • Reduced body weight and size

    • Ablation of rapid mitochondrial calcium uptake

    • Modest reduction in cardiac contractile reserve

    • Surprising resistance to calcium-induced mitochondrial permeability transition pore opening

Cardiac-specific models:

  • Dominant negative MCU expression (DN-MCU) in heart showed:

    • Minimal effect on basal heart structure or function

    • Reduced myocardial ATP content

    • Reduced basal sarcoplasmic reticulum calcium content

    • Protection against ischemia-reperfusion injury

Methodological considerations for knockout studies:

  • Consider background strain effects (C57BL/6 vs. CD1)

  • Distinguish between constitutive and inducible knockout models

  • Assess compensatory mechanisms that may develop

  • Examine both basal conditions and stress responses

  • Compare findings across multiple tissues and cell types

These models highlight the complex and context-dependent roles of MCU, suggesting that it may be more critical during stress conditions than for baseline function in some tissues .

What experimental approaches can detect altered MCU function in disease states?

To investigate MCU dysfunction in disease contexts, researchers employ multiple complementary techniques:

Genetic association studies:

  • Analyze MCU gene polymorphisms in large cohorts (e.g., All of Us Research Program)

  • Correlate genetic variants with disease phenotypes such as obesity or cardiac dysfunction

Ex vivo tissue analysis:

  • Isolate mitochondria from affected tissues

  • Measure calcium uptake capacity

  • Quantify MCU complex components via Western blot

  • Assess electron transport chain function and ATP production

In vivo disease models:

  • Utilize ischemia-reperfusion injury models

  • Apply adrenergic stress (e.g., isoproterenol infusion)

  • Measure cardiac function via echocardiography or direct hemodynamic assessment

  • Correlate with mitochondrial calcium handling

Molecular and structural approaches:

  • Generate disease-associated mutations in recombinant MCU

  • Assess channel function in reconstituted systems

  • Examine protein-protein interactions within the MCU complex

  • Utilize cryo-EM to determine structural alterations

For clinical translation, researchers often combine these approaches to link alterations in MCU function to disease mechanisms, potentially identifying new therapeutic targets.

How can I effectively design experiments to study MCU function in specific tissues?

Designing robust experiments to study MCU requires careful consideration of several factors:

Tissue-specific considerations:

  • Account for varying MCU:EMRE stoichiometry across tissues (brain, liver, kidney, heart have different ratios)

  • Consider the expression levels of regulatory components (MICU1, MICU2, MCUb)

  • Recognize that background strain influences viability of MCU knockout models

Recommended experimental workflow:

  • Begin with quantitative protein analysis to determine baseline expression levels

  • Implement genetic manipulation (knockout, knockdown, or overexpression)

  • Verify molecular changes at protein and mRNA levels

  • Assess mitochondrial calcium uptake in isolated mitochondria

  • Measure functional outcomes specific to the tissue of interest

  • Challenge with appropriate physiological or pathological stressors

Control considerations:

  • Include MCU inhibitor controls (Ruthenium Red or Ru360)

  • Compare against MCUb expression (endogenous dominant-negative form)

  • Use appropriate background strains (CD1 for knockout studies)

  • Consider compensatory mechanisms in chronic models

This systematic approach can help resolve apparent contradictions in the literature regarding MCU function across different tissues and experimental conditions.

What are the critical variables to control when measuring MCU-mediated calcium uptake?

Accurate measurement of MCU-mediated calcium uptake requires rigorous control of several variables:

Critical experimental parameters:

  • Membrane potential: Maintain consistent mitochondrial membrane potential, as calcium uptake is driven by the electrochemical gradient

  • Extra-mitochondrial calcium concentration: Use calibrated calcium indicators and standardized calcium additions

  • Buffer composition: Control for pH, ionic strength, and presence of other divalent cations

  • Energy status: Ensure consistent substrate availability (e.g., pyruvate/malate or succinate)

  • Temperature: Conduct experiments at physiologically relevant temperatures (37°C)

Validation controls:

  • Include MCU inhibitors (Ruthenium Red, Ru360) to confirm MCU-specific uptake

  • Perform parallel experiments with FCCP to collapse membrane potential as negative control

  • Use mitochondria from MCU-deficient models as biological negative controls

Data normalization approaches:

  • Normalize to mitochondrial protein content

  • Assess citrate synthase activity as a marker of mitochondrial mass

  • Consider normalizing to respiratory capacity

By controlling these variables, researchers can obtain reproducible measurements of MCU activity that allow for meaningful comparisons across experimental conditions and between different laboratories.

How can I resolve contradictory findings in MCU research literature?

The MCU research field contains several apparent contradictions that can be resolved through careful experimental design and interpretation:

Common contradictions and resolution approaches:

  • Embryonic lethality vs. viability of MCU knockout:

    • Resolution: Background strain effects are critical (C57BL/6 vs. CD1)

    • Approach: Specify genetic background and consider using tissue-specific conditional knockouts

  • Role in basal cardiac function vs. stress responses:

    • Resolution: MCU appears more critical during stress than baseline conditions

    • Approach: Test both unstressed and stressed conditions in the same model

  • Varying MCU:EMRE stoichiometry:

    • Resolution: Tissue-specific variation in complex composition

    • Approach: Quantify all components of the MCU complex in your specific tissue

  • Conflicting roles of regulatory proteins (MCUR1):

    • Resolution: Some effects may be indirect (e.g., via effects on membrane potential)

    • Approach: Measure membrane potential alongside calcium uptake

Methodological approaches to resolve contradictions:

  • Replicate key findings using multiple techniques

  • Carefully control experimental conditions

  • Directly compare methodologies when possible

  • Consider developmental and compensatory mechanisms

  • Account for tissue-specific differences in MCU complex composition

By addressing these factors systematically, researchers can help reconcile conflicting findings and advance understanding of MCU biology .

What are the promising therapeutic targets within the MCU complex for disease intervention?

Current research points to several potential therapeutic approaches targeting the MCU complex:

Promising therapeutic targets:

  • MCU stabilization:

    • Rationale: Uniporter stabilization during electron transport chain impairment prolongs survival in mitochondrial cardiomyopathies

    • Approach: Identify compounds that enhance MCU stability without causing calcium overload

    • Potential applications: Complex I deficiency, mitochondrial cardiomyopathies

  • MICU1/MICU2 modulation:

    • Rationale: Alterations in the calcium-sensing threshold could fine-tune mitochondrial calcium uptake

    • Approach: Target the calcium-binding EF-hands or the interaction between MICU1/2 and MCU-EMRE

    • Potential applications: Ischemia-reperfusion injury, neurodegenerative diseases

  • Tissue-specific MCU targeting:

    • Rationale: The varying stoichiometry of MCU:EMRE across tissues provides opportunity for selective targeting

    • Approach: Design compounds that recognize tissue-specific configurations of the MCU complex

    • Potential applications: Metabolic disorders, tissue-specific mitochondrial diseases

Experimental approaches to identify therapeutic targets:

  • High-throughput screening of compound libraries against reconstituted MCU complexes

  • Structure-based drug design targeting specific protein-protein interactions

  • Testing candidate compounds in disease-relevant cellular and animal models

The therapeutic potential of MCU modulation is particularly promising for conditions involving mitochondrial dysfunction, metabolic disorders, and calcium-mediated cell death.

What emerging technologies will advance MCU research in the coming years?

Several cutting-edge technologies are poised to revolutionize MCU research:

Emerging methodologies:

  • Cryo-electron tomography:

    • Application: Visualizing MCU complexes in their native mitochondrial membrane environment

    • Advantage: Provides structural insights without protein isolation or reconstitution

    • Impact: May reveal tissue-specific variations in complex assembly and organization

  • Genetically encoded calcium sensors with improved kinetics:

    • Application: Real-time monitoring of mitochondrial calcium dynamics

    • Advantage: Higher temporal resolution and sensitivity than current indicators

    • Impact: Better understanding of calcium microdomains and mitochondrial calcium uptake kinetics

  • CRISPR-based screening approaches:

    • Application: Identify novel regulators of MCU function

    • Advantage: Genome-wide unbiased discovery of MCU interactors and modulators

    • Impact: May reveal new therapeutic targets and regulatory mechanisms

  • Single-cell proteomics and metabolomics:

    • Application: Cell-specific analysis of MCU complex components and metabolic consequences

    • Advantage: Captures heterogeneity within tissues

    • Impact: Could identify cell populations particularly vulnerable to MCU dysfunction

These technologies will likely help resolve current controversies in the field and provide deeper insight into the context-dependent functions of MCU across different tissues and disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.