Recombinant Human Cardiolipin synthase (CRLS1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Human Cardiolipin Synthase (CRLS1) is a genetically engineered form of the human enzyme responsible for synthesizing cardiolipin (CL), a mitochondrial-specific phospholipid critical for maintaining mitochondrial membrane structure, energy metabolism, and signaling. CRLS1 catalyzes the final step of CL biosynthesis by transferring a phosphatidyl group from CDP-diacylglycerol to phosphatidylglycerol (PG) .

Protein Structure

  • Amino Acid Sequence: Full-length protein comprising 301 residues .

  • Molecular Weight: 32.6 kDa .

  • Isoforms: Two identified isoforms .

  • Domains: Belongs to the CDP-alcohol phosphatidyltransferase class-I family .

Enzymatic Activity

  • Localized to mitochondria .

  • Essential for CL remodeling, impacting mitochondrial cristae morphology and respiratory chain function .

Applications in Research

Recombinant CRLS1 is widely used to study:

  1. Mitochondrial Diseases: CRLS1 mutations cause severe encephalopathy, cardiomyopathy, and metabolic defects .

  2. Cancer Biology: Low CRLS1 expression correlates with poor prognosis in non-small cell lung cancer (NSCLC) .

  3. Metabolic Disorders: CRLS1 deficiency in adipose tissue disrupts thermogenesis and insulin sensitivity .

  4. Neurodegeneration: CRLS1-dependent CL synthesis is linked to mitochondrial stress responses in Parkinson’s disease models .

  5. Inflammation: CRLS1 regulates macrophage metabolic reprogramming during LPS-induced inflammation .

Table 1: CRLS1 in Disease and Metabolism

Study FocusKey FindingsSource
Cancer PrognosisLow CRLS1 mRNA in NSCLC predicts poor survival
Mitochondrial DiseaseCRLS1 variants impair CL synthesis, causing cardiomyopathy and encephalopathy
Adipose FunctionCRLS1 enhances thermogenic fat respiration and glucose uptake
InflammationCRLS1 knockdown disrupts LPS-induced metabolic switching in macrophages
NeuroprotectionCRLS1 upregulation via EVI1 transcription mitigates Parkinson’s pathology

Table 2: Recombinant CRLS1 Products

VendorProduct CodeApplicationsPrice
GeneBio SystemsSize: 50 µgResearch assays$315–$635
BiocompareMultiple antibodiesWB, IHC, ELISA$2,337+

Significance and Future Directions

Recombinant CRLS1 is indispensable for elucidating CL’s role in cellular metabolism, disease mechanisms, and therapeutic targeting. Current research highlights its potential as a biomarker in cancer and a therapeutic target for mitochondrial disorders . Future studies may explore CRLS1 modulation in metabolic syndrome and neurodegenerative diseases .

Product Specs

Form
Lyophilized powder
Note: While we will preferentially ship the format we have in stock, we understand you may have specific requirements. Please indicate your preferred format when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary based on your purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CRLS1; C20orf155; CLS1; Cardiolipin synthase; CMP-forming; CLS; Protein GCD10 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-301
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CRLS1
Target Protein Sequence
MLALRVARGSWGALRGAAWAPGTRPSKRRACWALLPPVPCCLGCLAERWRLRPAALGLRL PGIGQRNHCSGAGKAAPRPAAGAGAAAEAPGGQWGPASTPSLYENPWTIPNMLSMTRIGL APVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARNWANQRSALGSALDPLADKILISIL YVSLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPTF ISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCFTAFTTAASAYSYYHYGRKTVQVIK D
Uniprot No.

Target Background

Function
Cardiolipin synthase (CRLS1) is an enzyme that catalyzes the synthesis of cardiolipin (CL) (diphosphatidylglycerol) by specifically transferring a phosphatidyl group from CDP-diacylglycerol to phosphatidylglycerol (PG). CL is a crucial phospholipid found in mitochondrial membranes. It plays essential roles in maintaining the functional integrity and dynamics of mitochondria under both optimal and stressful conditions.
Gene References Into Functions
  1. Knockdown of human CRLS1 leads to a decrease in cardiolipin, an accumulation of phosphatidylglycerol, and mitochondrial elongation. PMID: 29251771
  2. Transgenic expression of cardiolipin synthase alleviated maladaptive cardiolipin remodeling and bioenergetic inefficiency in myocardium rendered diabetic by streptozotocin treatment. PMID: 22584571
  3. CLS mRNA levels do not correlate with CLS enzyme activity nor CL content in the LPS model of inflammation. PMID: 20652826
  4. A human candidate gene/cDNA for cardiolipin synthase, C20orf155, was identified. PMID: 16678169
  5. hCLS1 protein was localized to the mitochondria when transiently expressed in COS-7 cells PMID: 16716149
  6. This study describes a human gene for CLS and its analysis via RNAi knockdown on apoptotic progression. PMID: 16888643
  7. Anti-cardiolipin antibody positivity is an independent predictor of chronic renal failure PMID: 19048414
  8. Patients with solid and non-solid malignancies display anticardiolipin antibodies associated with an increased rate of thrombosis. PMID: 19048416
  9. The presence of cardiolipin autoantibodies is a diagnostic criterion for antiphospholipid syndrome. PMID: 19052923
  10. Cardiolipin antibodies are frequently observed in viral infections, particularly HIV, but not in bacterial infections. PMID: 19089659

Show More

Hide All

Database Links

HGNC: 16148

OMIM: 608188

KEGG: hsa:54675

STRING: 9606.ENSP00000368140

UniGene: Hs.743956

Protein Families
CDP-alcohol phosphatidyltransferase class-I family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in tissues such as heart, skeletal muscle and liver.

Q&A

What is the biological function of human Cardiolipin synthase (CRLS1)?

CRLS1 (Cardiolipin synthase 1) is an essential enzyme involved in the final step of cardiolipin (CL) biosynthesis in eukaryotic cells. It catalyzes the transfer of a phosphatidyl residue from CDP-diacylglycerol (CDP-DAG) to phosphatidylglycerol (PG), resulting in the formation of cardiolipin, a critical phospholipid predominantly found in the inner mitochondrial membrane. Cardiolipin plays a crucial role in maintaining proper mitochondrial structure and function, including oxidative phosphorylation, protein import, and apoptotic signaling pathways .

The enzyme is particularly important in tissues with high energy demands, as cardiolipin is essential for optimal mitochondrial respiratory chain activity. CRLS1 dysfunction has been linked to several pathological conditions, including mitochondrial encephalopathy and other multi-systemic disorders involving tissues with high metabolic activity .

Where is CRLS1 localized in human cells?

CRLS1 is predominantly localized to the mitochondria. This localization has been confirmed through multiple experimental approaches. Immunohistochemical analysis of recombinant human CLS1 (hCLS1) transiently expressed in COS-7 cells demonstrated mitochondrial localization . This mitochondrial targeting is consistent with the enzyme's function in cardiolipin biosynthesis, which occurs primarily in the inner mitochondrial membrane.

Subcellular fractionation analyses further corroborate the mitochondrial localization of the recombinant hCLS1 protein. This localization is essential for its functionality, as it places the enzyme in proximity to its substrate phosphatidylglycerol (PG) and the site of cardiolipin incorporation into mitochondrial membranes .

What is the gene structure and chromosomal location of human CRLS1?

The human CRLS1 gene consists of seven exons and is mapped to chromosome 20p13-p12.3, adjacent to the MCM8 (minichromosome maintenance protein-8) gene . The open reading frame of the hCLS1 gene encodes a 301-amino-acid protein with a predicted molecular weight of 32.6 kDa.

The protein contains features characteristic of a transmembrane protein and includes a conserved sequence motif [D(X)2DG(X)2AR(X)8–9G(X)3D(X)3D] that is found across the CLS family from yeast to plants. This conservation highlights the evolutionary importance of this enzyme in eukaryotic cells .

What is the expression pattern of CRLS1 in human tissues?

Northern-blot analysis has revealed that the hCLS1 gene is predominantly expressed in tissues that require high levels of mitochondrial activities for energy metabolism. The highest expression levels are observed in skeletal and cardiac muscles, consistent with the high energy demands of these tissues .

Additionally, high levels of hCLS1 expression have been detected in liver, pancreas, kidney, and small intestine, suggesting important functional roles in these metabolically active organs. This expression pattern aligns with the critical role of cardiolipin in supporting mitochondrial function in tissues with high energy requirements .

What is the exact enzymatic reaction catalyzed by CRLS1?

CRLS1 catalyzes the final step in the cardiolipin biosynthetic pathway by transferring a phosphatidyl group from CDP-diacylglycerol (CDP-DAG) to phosphatidylglycerol (PG), resulting in the formation of cardiolipin. The reaction can be represented as:

CDP-DAG + PG → Cardiolipin + CMP

This reaction occurs in the mitochondria and represents the committed step in cardiolipin synthesis. The enzyme requires magnesium ions (Mg²⁺) as a cofactor for optimal activity. The synthesis of cardiolipin is critical for maintaining proper mitochondrial membrane structure and function, particularly for the assembly and activity of respiratory chain complexes .

How can CRLS1 activity be measured in vitro?

CRLS1 activity can be measured using radioisotope-based assays. A typical in vitro assay contains:

  • 50 mM Tris/HCl (pH 8.0)

  • 4.0 mM MgCl₂

  • 20 μM [¹⁴C]oleoyl-CoA (50 mCi/mmol)

  • 2.0 mM LPG (1-oleoyl-2-hydroxy-sn-glycero-3-[phospho-rac-(1-glycerol)])

  • 2.0 mM CDP-DAG

The reaction is initiated by adding 50 μg of cell homogenates containing recombinant hCLS1 and incubated for 20 minutes at 30°C. The reaction products are then extracted using chloroform/methanol (2:1, v/v) followed by addition of 0.9% KCl to facilitate phase separation. The organic phase containing phospholipids is collected, dried under nitrogen, and separated by TLC (Thin Layer Chromatography) using chloroform/methanol/water (65:25:4, by vol.) as the developing solvent .

The radiolabeled cardiolipin product can be visualized using a phosphoimager and quantified by software such as ImageQuant. Alternative approaches include co-expressing CRLS1 with LPGAT1 (lysophosphatidylglycerol acyltransferase) to generate [¹⁴C]PG in situ as a substrate for the CLS assay .

How can recombinant human CRLS1 be expressed in cellular models?

Recombinant human CRLS1 can be efficiently expressed in mammalian cell lines such as COS-7 cells. A common approach involves:

  • Cloning the full-length hCLS1 cDNA into a mammalian expression vector

  • Adding an epitope tag (e.g., FLAG tag) to the N-terminus of hCLS1 to facilitate detection and purification

  • Transfecting the expression construct into COS-7 cells using standard transfection methods

  • Harvesting cells 48-72 hours post-transfection for protein analysis or enzymatic assays

When expressed in COS-7 cells, FLAG-tagged hCLS1 migrates on SDS-PAGE with an apparent molecular mass of approximately 32 kDa, consistent with the predicted molecular weight from its amino acid sequence. The C-terminus of the recombinant hCLS1 protein contains a major site for degradation, as indicated by the presence of a 28 kDa protein band on SDS-PAGE .

What cellular assays can demonstrate functional activity of recombinant CRLS1?

The functional activity of recombinant CRLS1 can be demonstrated through multiple approaches:

  • In vitro enzyme assays using cell homogenates containing recombinant CRLS1 and measuring the conversion of radiolabeled substrates to cardiolipin

  • Overexpression studies in COS-7 cells, which result in significant increases in cardiolipin synthesis without affecting the activity of endogenous phosphatidylglycerophosphate synthase

  • Rescue experiments in CRLS1-deficient cells or patient fibroblasts to confirm that wild-type CRLS1 can restore normal mitochondrial morphology and function

These assays provide complementary evidence for the functional activity of recombinant CRLS1. For example, overexpression of hCLS1 cDNA in COS-7 cells leads to increased cardiolipin synthesis only when both CDP-DAG and PG substrates are available, confirming the specificity of the enzyme activity .

What pathogenic variants of CRLS1 have been identified and how do they affect enzyme function?

Several pathogenic variants in CRLS1 have been identified in patients with mitochondrial disorders. Notable variants include:

  • p.(Ile109Asn) - Homozygous missense variant identified in three individuals with severe mitochondrial encephalopathy

  • p.(Ala172Asp) and p.(Leu217Phe) - Compound heterozygous variants identified in a fourth individual with a milder phenotype

These variants impair CRLS1 function, leading to deficient cardiolipin synthesis. Functional studies in patient-derived fibroblasts have demonstrated that these variants result in altered cardiolipin levels and composition. Specifically, fibroblasts from affected individuals show:

  • Reduced cardiolipin levels

  • Altered acyl-chain composition of remaining cardiolipin

  • Significantly increased levels of phosphatidylglycerol (the substrate of CRLS1)

These biochemical changes confirm the functional defect caused by the CRLS1 variants and establish their pathogenicity .

What clinical phenotypes are associated with CRLS1 deficiency?

CRLS1 deficiency is associated with a progressive mitochondrial encephalopathy with multi-systemic involvement. The clinical presentation can vary in severity but typically includes:

  • Progressive encephalopathy

  • Bull's eye maculopathy

  • Auditory neuropathy or sensorineural hearing loss

  • Diabetes insipidus

  • Autonomic instability

  • Cardiac defects

  • Early death in severe cases

Milder presentations may include chronic encephalopathy with neurodevelopmental regression, congenital nystagmus with decreased vision, failure to thrive, and acquired microcephaly. These clinical features highlight the critical role of cardiolipin in supporting mitochondrial function across multiple organ systems, particularly in tissues with high energy demands .

How does CRLS1 dysfunction affect mitochondrial morphology and function?

CRLS1 dysfunction severely impacts mitochondrial morphology and function through several mechanisms:

  • Altered mitochondrial morphology: Transmission electron microscopy (TEM) of patient fibroblasts shows that CRLS1-deficient mitochondria are smaller, rounder, and contracted compared to control mitochondria. They exhibit highly disordered cristae morphology with large areas devoid of cristae, indicating impaired cristae folding .

  • Impaired mitochondrial protein synthesis: Loss of cardiolipin reduces the rate of mitochondrial protein synthesis by decreasing the association of the translating mitoribosome with the inner mitochondrial membrane. Patient fibroblasts show reduced de novo mitochondrial translation rates for all 13 mitochondrially encoded proteins .

  • Compensatory responses: CRLS1-deficient cells exhibit an approximately 2-fold increase in mtDNA copy number, which represents a compensatory response to reduced mitochondrial protein synthesis .

  • OXPHOS defects: Cardiolipin deficiency leads to impaired assembly and function of respiratory chain complexes, particularly complex IV, resulting in reduced oxidative phosphorylation capacity .

These structural and functional abnormalities highlight the critical role of cardiolipin in maintaining proper mitochondrial architecture and function.

What methods can be used to assess the impact of CRLS1 variants on cardiolipin metabolism?

Several complementary approaches can be used to assess the impact of CRLS1 variants on cardiolipin metabolism:

These methods provide comprehensive characterization of the functional consequences of CRLS1 variants at the biochemical, cellular, and molecular levels.

How can omics technologies be applied to study CRLS1-related disorders?

Omics technologies offer powerful approaches to study CRLS1-related disorders comprehensively:

  • Lipidomics: Mass spectrometry-based lipidomic profiling can quantify changes in cardiolipin levels and acyl-chain composition, as well as alterations in other phospholipid species that may compensate for cardiolipin deficiency. This approach has identified key signatures in cardiolipin profiles across various degrees of cardiolipin loss .

  • Proteomics: Proteomic profiling of patient cells and mouse Crls1 knockout cell lines has identified both endoplasmic reticular and mitochondrial stress responses. Proteomic analysis can reveal key features that distinguish between varying degrees of cardiolipin insufficiency, providing potential biomarkers for disease severity and progression .

  • Genomics: Whole exome sequencing (WES) has been instrumental in identifying causative CRLS1 variants in affected individuals. Trio WES, which includes sequencing of both parents and the affected individual, is particularly effective for identifying recessive disease-causing variants .

  • Transcriptomics: RNA-seq analysis can identify changes in gene expression patterns in response to cardiolipin deficiency, revealing compensatory mechanisms and cellular stress responses.

These omics approaches provide complementary information that can guide diagnosis and deepen understanding of disease mechanisms in CRLS1-related disorders.

What cellular models are available to study CRLS1 function and dysfunction?

Several cellular models are available to study CRLS1 function and dysfunction:

  • Patient-derived fibroblasts: Primary fibroblasts from patients with pathogenic CRLS1 variants provide a disease-relevant model to study the cellular consequences of CRLS1 dysfunction. These cells exhibit characteristic mitochondrial abnormalities, including altered morphology and reduced respiratory chain activity .

  • Crls1 knockout cell lines: Mouse Crls1 knockout cell lines have been generated using genetic engineering approaches. These cells completely lack cardiolipin and serve as models for severe cardiolipin deficiency. They exhibit impaired coordination of mitochondrial protein synthesis and OXPHOS biogenesis .

  • Overexpression systems: COS-7 cells transfected with hCLS1 expression constructs provide a system to study the enzymatic activity and subcellular localization of wild-type and mutant CRLS1 proteins .

  • Rescue models: Re-expression of wild-type CRLS1 in patient fibroblasts or knockout cell lines can confirm the pathogenicity of CRLS1 variants and establish causality between CRLS1 dysfunction and cellular phenotypes .

These complementary model systems allow for comprehensive investigation of CRLS1 function at the biochemical, cellular, and molecular levels.

What potential therapeutic approaches might address CRLS1 deficiency?

While currently there are no approved treatments specifically for CRLS1 deficiency, several potential therapeutic approaches warrant investigation:

Development of these therapeutic approaches requires deeper understanding of cardiolipin metabolism and the cellular consequences of its deficiency.

What are the most important unanswered questions in CRLS1 research?

Several critical questions remain unanswered in CRLS1 research:

  • Tissue-specific effects: Why do CRLS1 variants affect certain tissues (brain, retina, heart, cochlea) more severely than others, despite the ubiquitous requirement for mitochondrial function?

  • Genotype-phenotype correlations: What factors determine the severity of clinical presentation in individuals with different CRLS1 variants?

  • Compensatory mechanisms: How do cells partially adapt to cardiolipin deficiency, and can these mechanisms be therapeutically enhanced?

  • Interaction with other mitochondrial disorders: How does CRLS1 deficiency interact with other mitochondrial diseases or with acquired conditions affecting mitochondrial function?

  • Biomarkers: Can specific cardiolipin species or proteomic signatures serve as reliable biomarkers for diagnosis, prognosis, or treatment monitoring in CRLS1-related disorders?

Addressing these questions will require integrated approaches combining patient studies, cellular and animal models, and cutting-edge omics technologies. The answers will not only advance understanding of CRLS1 biology but may also provide insights into broader aspects of mitochondrial membrane dynamics and function in health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.