Recombinant Human Catechol O-methyltransferase domain-containing protein 1 (COMTD1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Catechol O-methyltransferase Domain-Containing Protein 1 (COMTD1)

Recombinant Human Catechol O-methyltransferase domain-containing protein 1 (COMTD1) is a protein produced through recombinant DNA technology, typically in an in vitro E. coli expression system . This protein is encoded by the COMTD1 gene, which is identified by the Gene ID 118881 in the human genome . Despite its classification as a catechol O-methyltransferase domain-containing protein, the biological function of COMTD1 remains poorly understood, although recent studies have begun to shed light on its potential roles.

Biological Function and Localization

Recent research has shown that COMTD1 is localized to mitochondria in pigment cells . A study involving a frame-shift mutation in the COMTD1 gene demonstrated that this mutation is associated with impaired production of pheomelanin, a type of melanin. The study suggests that COMTD1 may protect pigment cells from oxidative stress, which is crucial for the synthesis of pheomelanin . This protective role could potentially extend to other cell types as well.

Research Findings and Clinical Implications

COMTD1 has been identified as one of the genes involved in DNA methylation analyses, alongside other genes like HTR1E, which are functionally related to serotonin receptors . Additionally, COMTD1 has been implicated in cancer research, particularly in breast cancer (BC), where it is part of a prognostic model that predicts patient outcomes . The model incorporates COMTD1 along with other mitochondrial-related genes to stratify BC patients into high-risk and low-risk groups based on their expression levels.

Recombinant Production and Applications

Recombinant Human COMTD1 is produced in an E. coli expression system, which allows for controlled and efficient production of the protein for research purposes . This recombinant protein can be used in various biochemical assays to study its enzymatic activity, interactions, and potential therapeutic applications.

Table 1: Information on Recombinant Human COMTD1

ParameterDescription
Gene ID118881
SourceE. coli expression system
FunctionO-methyltransferase domain-containing protein
LocalizationMitochondria in pigment cells

Table 2: Research Implications

Study AreaFindings
Biological FunctionProtects pigment cells from oxidative stress, involved in pheomelanin synthesis
Cancer ResearchPart of a prognostic model for breast cancer
DNA MethylationIdentified in methylation analyses related to serotonin receptors

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
COMTD1; UNQ766/PRO1558; Catechol O-methyltransferase domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-262
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
COMTD1
Target Protein Sequence
MTQPVPRLSVPAALALGSAALGAAFATGLFLGRRCPPWRGRREQCLLPPEDSRLWQYLLS RSMREHPALRSLRLLTLEQPQGDSMMTCEQAQLLANLARLIQAKKALDLGTFTGYSALAL ALALPADGRVVTCEVDAQPPELGRPLWRQAEAEHKIDLRLKPALETLDELLAAGEAGTFD VAVVDADKENCSAYYERCLQLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIR RDVRVYISLLPLGDGLTLAFKI
Uniprot No.

Target Background

Function

Putative O-methyltransferase.

Database Links

HGNC: 26309

KEGG: hsa:118881

STRING: 9606.ENSP00000361616

UniGene: Hs.355333

Protein Families
Class I-like SAM-binding methyltransferase superfamily, Cation-dependent O-methyltransferase family
Subcellular Location
Membrane; Single-pass type II membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.