Recombinant Human Cation channel sperm-associated protein 3 (CATSPER3)

Shipped with Ice Packs
In Stock

Description

Functional Role in Sperm Physiology

CATSPER3 is a pore-forming subunit of the CatSper complex, which regulates calcium influx into sperm cells. Key functional roles include:

  • Sperm Hyperactivation: Required for vigorous, asymmetric flagellar beating essential for penetrating the zona pellucida .

  • Acrosome Reaction: Facilitates calcium-dependent exocytosis of the acrosome, enabling sperm-egg fusion .

  • Chemotaxis: Mediates directional movement toward the oocyte via calcium signaling .

Table 1: Phenotypic Effects of CATSPER3 Deficiency

ModelPhenotypeReference
Catsper3 KO miceInfertility; loss of sperm motility and hyperactivation
Human mutationFailed acrosome reaction; normal semen parameters but infertility
Ascidian KO modelReduced motility, impaired chemotaxis, developmental defects

Associated Proteins and Complex Interactions

CATSPER3 interacts with other CatSper subunits and auxiliary proteins to form a functional channel:

Table 2: Key Interaction Partners of CATSPER3

ProteinRoleInteraction Score
CATSPER1Core pore-forming subunit0.985
CATSPER2Voltage-sensing and channel regulation0.986
EFCAB9Calcium sensor required for channel activation0.983
CATSPERZStructural component of the channel nanodomain0.943

Sources:

Experimental Applications of Recombinant CATSPER3

Recombinant CATSPER3 is widely used in fertility research:

  • Antibody Production: Immunogens for generating antibodies targeting specific epitopes .

  • Functional Studies: In vitro assays to assess calcium flux and channel activity .

  • Structural Analysis: Mapping interaction domains via co-immunoprecipitation .

Table 3: Recombinant CATSPER3 Constructs

ConstructExpression HostTagApplications
Full-length (1–398 aa)E. coliHisWB, functional assays
Fragment (299–398 aa)Wheat germGSTELISA, protein interactions

Sources:

Clinical Relevance and Therapeutic Insights

Mutations in CATSPER3 are linked to non-syndromic male infertility. Notable findings include:

  • A homozygous c.707T>A mutation in humans caused acrosome reaction failure but allowed successful pregnancy via ICSI .

  • CATSPER3-deficient sperm retain nuclear integrity, making ICSI a viable treatment .

  • Potential target for male contraceptives due to its sperm-specific expression .

Regulatory Mechanisms

Transcriptional regulation of CATSPER3 involves CREMτ and CREB1α, which bind CRE sites in its promoter . This TATA-independent promoter is active in testis, ensuring tissue-specific expression.

Evolutionary Conservation

CATSPER3 is highly conserved across mammals (e.g., 99.2% identity between chimpanzees and humans) . Rodent models show analogous roles in fertility, validating its translational relevance .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
CATSPER3; Cation channel sperm-associated protein 3; CatSper3; Ca(v-like protein; One-repeat calcium channel-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-398
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CATSPER3
Target Protein Sequence
MSQHRHQRHSRVISSSPVDTTSVGFCPTFKKFKRNDDECRAFVKRVIMSRFFKIIMISTV TSNAFFMALWTSYDIRYRLFRLLEFSEIFFVSICTSELSMKVYVDPINYWKNGYNLLDVI IIIVMFLPYALRQLMGKQFTYLYIADGMQSLRILKLIGYSQGIRTLITAVGQTVYTVASV LLLLFLLMYIFAILGFCLFGSPDNGDHDNWGNLAAAFFTLFSLATVDGWTDLQKQLDNRE FALSRAFTIIFILLASFIFLNMFVGVMIMHTEDSIRKFERELMLEQQEMLMGEKQVILQR QQEEISRLMHIQKNADCTSFSELVENFKKTLSHTDPMVLDDFGTSLPFIDIYFSTLDYQD TTVHKLQELYYEIVHVLSLMLEDLPQEKPQSLEKVDEK
Uniprot No.

Target Background

Function
Voltage-gated calcium channel that plays a critical role in calcium-dependent physiological responses crucial for successful fertilization. These responses include sperm hyperactivation, acrosome reaction, and chemotaxis towards the oocyte.
Gene References Into Functions
  1. Catsper3 possesses a single channel-forming domain, a pore-loop with the consensus sequence TxDxW, and a coiled-coil protein-protein interaction domain in the C-terminal tail. CatSpers 1, 2, 3, and 4 may interact directly or indirectly to form a functional tetramer. PMID: 12932298
  2. PMID: 12646162 concludes that Alu repeats interfere with splicing of DCOHM and CAVL, resulting in transcripts containing exons from both genes. PMID: 12646162
Database Links

HGNC: 20819

OMIM: 609120

KEGG: hsa:347732

STRING: 9606.ENSP00000282611

UniGene: Hs.631804

Protein Families
Cation channel sperm-associated (TC 1.A.1.19) family
Subcellular Location
Cell projection, cilium, flagellum membrane; Multi-pass membrane protein. Note=Specifically located in the principal piece of sperm tail.
Tissue Specificity
Testis-specific.

Q&A

What is CATSPER3 and what is its biological function?

CATSPER3 (Cation Channel Sperm Associated 3) is a protein-coding gene located on chromosome 5q31.1 in humans. It encodes a 398-amino-acid protein that forms part of a voltage-gated calcium channel complex specific to sperm cells . The protein contains a single six-transmembrane repeat domain, where the fourth transmembrane region resembles a voltage sensor and a pore region containing the consensus sequence TxDxW .

Functionally, CATSPER3 is involved in:

  • Calcium ion transport in sperm cells

  • Sperm motility regulation

  • Acrosome reaction processes essential for fertilization

  • Sperm chemotaxis toward egg cells

The sequences of CATSPER3 have been established to be highly conserved in several mammalian species during evolution, with similarity ranging from 61.1% (mouse vs. rat) to 99.2% (chimpanzee vs. human) . This high conservation underscores its evolutionary importance in reproductive biology.

How do researchers detect and quantify CATSPER3 expression in tissue samples?

Researchers typically use quantitative reverse transcription polymerase chain reaction (qRT-PCR) to detect and quantify CATSPER3 expression. The methodology involves:

  • RNA extraction from tissues of interest

  • cDNA synthesis through reverse transcription

  • Quantitative PCR using CATSPER3-specific primers

  • Normalization against housekeeping genes (e.g., GAPDH)

A standard protocol includes:

  • Using equal amounts of cDNA from each tissue sample

  • Employing commercial reagents such as PowerUp SYBR Green Master Mix

  • Running reactions with approximately 500 nM of each primer

  • Performing 40 PCR cycles with specific temperature parameters:

    • Polymerase activation at 95°C for 20s

    • Denaturation at 95°C for 3s

    • Annealing and extension at 60°C for 30s

    • Melt-curve analysis to confirm primer specificity

For visualization of expression patterns, whole-mount in situ hybridization (WISH) can be performed using digoxigenin-labeled antisense RNA probes synthesized from T7-RNA polymerase promoter-attached amplified cDNA .

What is the structure of the CATSPER3 protein and how does it contribute to ion channel function?

The human CATSPER3 protein consists of 398 amino acids and features:

  • Six transmembrane domains (similar to other voltage-gated ion channels)

  • A voltage sensor in the fourth transmembrane domain

  • A pore region with the consensus sequence TxDxW

  • A C-terminal coiled-coil protein-protein interaction region

The functional protein forms part of a heterotetrameric calcium channel complex with other CATSPER family members (CATSPER1, CATSPER2, and CATSPER4). This complex is essential for calcium ion influx into sperm cells, which regulates various sperm functions.

When mutations occur, such as the c.707T>A variant that creates a premature stop codon (p.L236*), the resulting truncated protein loses C-terminal 162 amino acid residues, including the sixth transmembrane region and the coiled-coil protein-protein interaction region . This structural alteration disrupts normal calcium ion channel function, leading to infertility despite normal sperm parameters in routine analyses.

How can researchers generate and validate CATSPER3 knockout models?

Creating CATSPER3 knockout models requires sophisticated genetic engineering techniques. Based on research experiences, the CRISPR/Cas9 system has proven effective for generating CATSPER3 knockouts in animal models. The methodology includes:

  • Design of target sequences specific to CATSPER3 exons using tools like ZiFiT

  • Construction of guide RNA (gRNA) expression vectors

  • In vitro transcription of gRNAs and Cas9 mRNAs

  • Microinjection of embryos with the CRISPR/Cas9 components

  • Screening of potential knockouts through DNA sequencing

For example, in ascidian models, researchers designed a target sequence of gRNA specific for CATSPER3 (5′-CGAAAGCGAAGTTTTTAATGGTCT-3′) at exon 5 . After microinjection, DNA sequencing was used to confirm successful editing through the identification of deletions or insertions in the target region.

Validation of knockout models should include:

  • Molecular verification of genetic alterations

  • Expression analysis to confirm protein absence

  • Phenotypic characterization (e.g., growth rate, fertility potential)

  • Functional tests specific to sperm calcium signaling

Researchers should note that CATSPER3 knockout animals may exhibit reduced viability and growth rates, as observed in ascidian models where knockout animals had significantly smaller body sizes compared to wild-type animals .

What methodologies are most effective for assessing the impact of CATSPER3 mutations on sperm function?

To comprehensively evaluate how CATSPER3 mutations affect sperm function, researchers should employ a multi-faceted approach:

  • Acrosome Reaction Assessment:

    • Anti-CD46 immunofluorescence analysis to visualize acrosomal status

    • Flow cytometry with acrosome-specific fluorescent markers

    • Calcium imaging during induced acrosome reaction

  • Calcium Influx Measurement:

    • Patch-clamp recordings of calcium currents

    • Calcium-sensitive fluorescent dyes (e.g., Fluo-4) coupled with confocal microscopy

    • Real-time calcium imaging during exposure to physiological stimuli

  • Motility Analysis:

    • Computer-assisted sperm analysis (CASA) for detailed motility parameters

    • High-speed videomicroscopy to capture flagellar beat patterns

    • Microfluidic devices to assess chemotactic responses

  • Fertilization Capacity:

    • In vitro fertilization assays

    • Zona pellucida binding tests

    • Intracytoplasmic sperm injection outcomes

Studies have shown that CATSPER3 mutations may specifically affect the acrosome reaction while sparing other parameters such as sperm count, morphology, and initial motility . This highlights the importance of comprehensive functional testing beyond routine semen analysis.

How do recombinant CATSPER3 proteins contribute to structural and functional studies?

Recombinant CATSPER3 proteins serve as valuable tools for structural and functional investigations. These proteins can be produced with various tags (e.g., GST, His) to facilitate purification and detection. For instance, commercially available Human CATSPER3 partial ORF (NP_821138, 299 a.a. - 398 a.a.) recombinant protein with GST-tag at N-terminal has been reported .

Applications of recombinant CATSPER3 proteins include:

  • Structural Studies:

    • X-ray crystallography to determine three-dimensional structure

    • Cryo-electron microscopy for complex formation analysis

    • Protein-protein interaction studies to identify binding partners

  • Functional Assays:

    • In vitro ion channel reconstitution experiments

    • Electrophysiological recordings in heterologous expression systems

    • Binding assays with potential ligands or modulators

  • Antibody Production:

    • Generation of specific antibodies for localization studies

    • Development of diagnostic tools for CATSPER3-related infertility

  • Protein Array Applications:

    • High-throughput screening of interacting proteins

    • Identification of post-translational modifications

When working with recombinant CATSPER3 proteins, researchers should consider:

  • Optimal storage conditions (e.g., -80°C, with aliquoting to avoid repeated freeze-thaw cycles)

  • Appropriate buffer composition (e.g., 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0)

  • Potential limitations of partial protein constructs versus full-length proteins

How can researchers identify and characterize CATSPER3 mutations in infertile patients?

Identification of CATSPER3 mutations in clinical samples involves a systematic genetic approach:

  • Whole-Exome Sequencing (WES):

    • This approach has successfully identified novel CATSPER3 variants

    • Sequence coverage should be at least 90-95% of targeted bases

    • Average sequencing depth should be >100x for reliable variant detection

  • Variant Filtering Pipeline:

    • Filter variants against population databases (1000 Genomes Project, ExAC, gnomAD)

    • Prioritize rare variants (allele frequency <0.001)

    • Focus on variants in coding regions and splice sites

  • Validation and Segregation Analysis:

    • Confirm variants using Sanger sequencing

    • Perform segregation analysis in family members when possible

    • Construct pedigrees to identify inheritance patterns

  • Variant Pathogenicity Assessment:

    • Use prediction tools (e.g., Mutation Taster, CADD) to evaluate potential impact

    • Check conservation across species

    • Assess protein structural implications using modeling tools

For example, a homozygous nonsense variant (c.707T>A, p.L236*) in exon 5 of CATSPER3 was identified in a patient with primary infertility from a consanguineous family. This variant creates a premature stop codon and produces a truncated protein predicted to be disease-causing by Mutation Taster (probability value: 0.99999999) and damaging by CADD (Phred-scaled score: 39) .

What methodological approaches can determine the efficacy of assisted reproductive technologies for patients with CATSPER3 mutations?

For patients with CATSPER3 mutations, assisted reproductive technologies (ARTs) may offer fertility solutions. Researchers can evaluate the efficacy of these approaches through:

  • Comparative ART Outcome Studies:

    • Track success rates of different ART methods (conventional IVF vs. ICSI)

    • Monitor embryo development rates and quality

    • Assess implantation, clinical pregnancy, and live birth rates

  • Sperm Function Pre-Assessment:

    • Evaluate acrosome reaction capacity before ART

    • Test calcium signaling responses to physiological stimuli

    • Assess zona pellucida binding ability

  • Embryo Development Monitoring:

    • Time-lapse imaging of embryo development

    • Assessment of fertilization markers

    • Evaluation of embryo morphokinetics

  • Long-term Outcome Tracking:

    • Follow-up on pregnancy progression

    • Monitor neonatal outcomes

    • Assess long-term development of offspring

Research indicates that ICSI may be the most appropriate therapy for patients with CATSPER3 mutations. In a case study, a patient with a homozygous CATSPER3 mutation underwent successful ICSI treatment, suggesting that while the mutation affects sperm function, it does not impact the sperm nucleus integrity necessary for embryonic development .

This supports the hypothesis that CATSPER3 deficiencies primarily affect sperm-egg interaction processes that are bypassed by ICSI rather than affecting the genetic material required for embryo development.

How should researchers design experiments to study CATSPER3 function across different species models?

When designing cross-species CATSPER3 experiments, researchers should consider several methodological factors:

  • Species Selection:

    • Choose species with varying evolutionary distances

    • Include both model organisms (mouse, rat) and non-model organisms

    • Consider species with different reproductive strategies

  • Sequence Homology Analysis:

    • Perform comprehensive sequence alignments

    • Identify conserved domains and species-specific variations

    • Focus on functional domains (transmembrane regions, pore-forming domains)

  • Expression Pattern Comparison:

    • Use compatible methodologies across species (qRT-PCR, in situ hybridization)

    • Compare tissue-specific expression profiles

    • Analyze developmental timing of expression

  • Functional Conservation Testing:

    • Create equivalent mutations across species

    • Perform rescue experiments with cross-species gene replacement

    • Compare phenotypic outcomes of knockouts/mutations

The high conservation of CATSPER3 sequences across mammalian species (61.1-99.2% similarity) suggests functional importance but may mask species-specific adaptations . Researchers should be aware that cellular localization may differ between species; for example, in mice, CatSper3 is mainly located in the sperm acrosome, which differs from the localization patterns of CatSper1 and CatSper2 (in the sperm principle piece and flagella) .

What are the best practices for producing and purifying functional recombinant CATSPER3 proteins?

For optimal production and purification of functional recombinant CATSPER3 proteins, researchers should follow these methodological guidelines:

  • Expression System Selection:

    • Wheat germ cell-free systems have been successfully used

    • Consider mammalian expression systems for proper folding and post-translational modifications

    • Insect cell systems may balance yield and functionality

  • Construct Design:

    • For membrane proteins like CATSPER3, consider expressing functional domains separately

    • Include appropriate tags (His, GST) for purification

    • Design constructs that minimize hydrophobic transmembrane regions if expressing in E. coli

  • Purification Strategy:

    • Use affinity chromatography based on the selected tag

    • Implement size exclusion chromatography for higher purity

    • Consider detergent selection carefully for membrane protein solubilization

  • Functional Validation:

    • Verify protein folding through circular dichroism

    • Assess oligomerization state through native PAGE or analytical ultracentrifugation

    • Confirm ion channel functionality through reconstitution in liposomes or electrophysiology

For storage and stability:

  • Store at -80°C

  • Aliquot to avoid repeated freezing and thawing

  • Use appropriate buffer conditions (e.g., 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0)

How can researchers reconcile contradictory findings regarding CATSPER3's role in sperm motility?

Contradictory findings regarding CATSPER3's impact on sperm motility present significant interpretational challenges. To address these contradictions, researchers should implement the following methodological approaches:

  • Standardized Motility Assessment:

    • Use consistent computer-assisted sperm analysis (CASA) parameters

    • Employ standardized media compositions and incubation conditions

    • Analyze multiple motility parameters (velocity, linearity, amplitude of lateral head displacement)

  • Temporal Analysis:

    • Evaluate motility at multiple time points post-activation

    • Distinguish between initial motility and sustained motility

    • Assess hyperactivation separately from basic motility

  • Context-Dependent Effects:

    • Test motility under various physiological conditions (different pH, calcium concentrations)

    • Evaluate motility in response to known physiological stimulants

    • Consider species-specific differences in regulation

  • Integration with Other Functions:

    • Correlate motility findings with calcium signaling measurements

    • Assess motility in context of acrosome reaction status

    • Consider compensatory mechanisms in knockout models

For example, some studies suggest that lack of Catsper3 does not influence the initial motility of mouse sperm , while other research indicates that CatSper mediates both chemotactic behavior and motility . This apparent contradiction may be reconciled by considering that:

  • CATSPER3 may affect specific aspects of motility (hyperactivation) but not others (initial motility)

  • Effects may differ across species or experimental conditions

  • Compensatory mechanisms may mask effects in some experimental models

  • The cellular location of CatSper3 (mainly in the sperm acrosome) differs from other CatSper proteins, potentially explaining functional differences

What statistical approaches are most appropriate for analyzing CATSPER3 expression data across tissues and developmental stages?

For robust statistical analysis of CATSPER3 expression data, researchers should consider:

  • Normalization Strategies:

    • Use multiple reference genes for qRT-PCR normalization

    • Apply geometric averaging of reference genes (e.g., geNorm approach)

    • Consider global normalization methods for RNA-seq data

  • Statistical Tests Selection:

    • For comparing expression across multiple tissues: ANOVA with appropriate post-hoc tests

    • For developmental time series: repeated measures ANOVA or mixed models

    • For non-normally distributed data: non-parametric alternatives (Kruskal-Wallis, Friedman test)

  • Multiple Testing Correction:

    • Apply Benjamini-Hochberg procedure for controlling false discovery rate

    • Use Bonferroni correction for stringent control of family-wise error rate

    • Report both corrected and uncorrected p-values for transparency

  • Visualization Approaches:

    • Heat maps for multi-tissue comparison

    • Line graphs for developmental progression

    • Box plots with individual data points for distribution transparency

When testing hypotheses about differential expression:

  • Clearly define the null hypothesis

  • Calculate appropriate sample sizes through power analysis

  • Consider biological replicates (different individuals) rather than just technical replicates

  • Report effect sizes alongside p-values

What emerging technologies might advance our understanding of CATSPER3 function and regulation?

Several cutting-edge technologies hold promise for deepening our understanding of CATSPER3:

  • Single-Cell Technologies:

    • Single-cell RNA-seq to identify heterogeneity in CATSPER3 expression among sperm populations

    • Single-molecule imaging to track CATSPER3 dynamics in live sperm

    • Mass cytometry for multi-parameter analysis of CATSPER3 in relation to other proteins

  • Advanced Imaging Approaches:

    • Super-resolution microscopy (STORM, PALM) for nanoscale localization

    • Cryo-electron tomography for structural characterization in native membrane

    • Correlative light and electron microscopy to link function and structure

  • Genome Engineering Refinements:

    • Base editing for precise modification of CATSPER3 sequence

    • Prime editing for flexible gene editing without double-strand breaks

    • Conditional/inducible knockout systems for temporal control

  • Computational Methods:

    • Molecular dynamics simulations of ion channel function

    • Machine learning for prediction of mutation effects

    • Systems biology approaches to model CATSPER3 in calcium signaling networks

These technologies could address key questions including:

  • How CATSPER3 interacts with other subunits to form functional channels

  • The precise temporal dynamics of CATSPER3 activation during fertilization

  • Potential non-reproductive roles of CATSPER3 in other tissues

  • Pharmacological modulation strategies for fertility intervention

How might CATSPER3 research contribute to novel fertility treatments or contraceptive approaches?

CATSPER3 research has significant translational potential in reproductive medicine:

  • Diagnostic Applications:

    • Development of genetic screening panels for CATSPER3 mutations in unexplained male infertility

    • Functional assays to assess CATSPER3-related calcium signaling defects

    • Predictive models for ART success based on CATSPER3 status

  • Therapeutic Approaches:

    • Gene therapy strategies to correct CATSPER3 mutations

    • Development of CATSPER3 activators for fertility enhancement

    • Personalized ART protocols based on CATSPER3 function

  • Contraceptive Development:

    • CATSPER3 inhibitors as non-hormonal male contraceptives

    • Sperm-specific delivery systems for CATSPER3-targeting compounds

    • Reversible modulation strategies for controlled fertility

  • Combination Approaches:

    • Targeting multiple CatSper family members simultaneously

    • Modulating CatSper function alongside other sperm-specific targets

    • Developing multimodal approaches for enhanced efficacy

The specificity of CATSPER3 expression to sperm cells makes it an attractive target for both fertility enhancement and contraception, with potential for fewer systemic side effects compared to hormone-based approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.