Recombinant Human Cation channel sperm-associated protein 4 (CATSPER4)

Shipped with Ice Packs
In Stock

Description

Functional Role in Sperm Physiology

CATSPER4 is a pore-forming subunit of the CatSper channel complex, which regulates calcium influx essential for:

  • Sperm Hyperactivation: Knockout studies in mice show CATSPER4 is required for hyperactivated motility and male fertility .

  • Channel Assembly: CATSPER4 interacts with auxiliary subunits (e.g., CATSPERθ) to stabilize the channel structure . Loss of CATSPERθ disrupts CATSPER4 integration into the complex, impairing sperm flagellar targeting .

  • pH and Voltage Sensitivity: The channel’s activity is modulated by intracellular pH shifts, with CATSPER4 contributing to voltage-dependent gating .

Applications in Research

  • Infertility Studies: Recombinant CATSPER4 aids in identifying mutations or dysregulation in idiopathic male infertility .

  • Drug Development: The channel is a potential target for non-hormonal male contraceptives due to its sperm-specific role .

  • Structural Biology: Crystallization-grade recombinant CATSPER4 supports cryo-EM studies of the CatSper complex .

Key Research Findings

Study FocusKey ResultSource
Knockout PhenotypeCatsper4⁻/⁻ mice exhibit complete male infertility due to motility loss
Channel AssemblyCATSPER4 stability depends on CATSPERθ; co-IP confirms direct interaction
PharmacologyProgesterone and prostaglandins activate human CatSper via CATSPER4
Evolutionary RoleCATSPER4 homologs in ascidians and mammals show conserved fertility roles

Challenges and Future Directions

  • Heterologous Expression: Full functional reconstitution of CATSPER4 in vitro remains elusive due to dependency on auxiliary subunits .

  • Species-Specific Variations: Mouse and human CATSPER4 share 62% sequence identity, necessitating caution in translational studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your preparations.
Shelf Life
Shelf life is influenced by various factors including storage state, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
CATSPER4; Cation channel sperm-associated protein 4; CatSper4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-472
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CATSPER4
Target Protein Sequence
MRDNEKAWWQQWTSHTGLEGWGGTQEDRMGFGGAVAALRGRPSPLQSTIHESYGRPEEQV LINRQEITNKADAWDMQEFITHMYIKQLLRHPAFQLLLALLLVINAITIALRTNSYLDQK HYELFSTIDDIVLTILLCEVLLGWLNGFWIFWKDGWNILNFIIVFILLLRFFINEINIPS INYTLRALRLVHVCMAVEPLARIIRVILQSVPDMANIMVLILFFMLVFSVFGVTLFGAFV PKHFQNIQVALYTLFICITQDGWVDIYSDFQTEKREYAMEIGGAIYFTIFITIGAFIGIN LFVIVVTTNLEQMMKAGEQGQQQRITFSETGAEEEEENDQLPLVHCVVARSEKSGLLQEP LAGGPLSNLSENTCDNFCLVLEAIQENLRQYKEIRDELNMIVEEVRAIRFNQEQESEVLN RRSSTSGSLETTSSKDIRQMSQQQDLLSALVSMEKVHDSSSQILLKKHKSSH
Uniprot No.

Target Background

Function
Voltage-gated calcium channel that plays a crucial role in calcium-dependent physiological responses, vital for successful fertilization. These responses include sperm hyperactivation, acrosome reaction, and chemotaxis towards the oocyte.
Gene References Into Functions
  1. Observational study of gene-disease association. (HuGE Navigator) PMID: 20546612
  2. Catsper4 possesses a single channel-forming domain, a pore-loop with the consensus sequence TxDxW, and a coiled-coil protein-protein interaction domain in the C-terminal tail. CatSpers 1,2,3 & 4 may interact directly or indirectly to form a functional tetramer. PMID: 12932298
  3. Observational study and genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 19343178
Database Links

HGNC: 23220

OMIM: 609121

KEGG: hsa:378807

STRING: 9606.ENSP00000390423

UniGene: Hs.123532

Protein Families
Cation channel sperm-associated (TC 1.A.1.19) family
Subcellular Location
Cell projection, cilium, flagellum membrane; Multi-pass membrane protein. Note=Specifically located in the principal piece of sperm tail.
Tissue Specificity
Testis-specific.

Q&A

What is the tissue specificity of CATSPER4 expression?

CATSPER4 expression is highly specific to the testis and mature sperm cells, as confirmed by Northern blot analysis and in situ hybridization studies. The gene exhibits stage-specific expression during spermatogenesis, with expression absent in early spermatocytes and somatic cells within the testis. This strict tissue specificity makes CATSPER4 an excellent candidate for reproductive biology studies focused on sperm-specific processes .

Where is CATSPER4 protein localized in sperm cells?

Immunocytochemistry studies have demonstrated that CATSPER4 is specifically localized to the principal piece of the sperm flagellum. This localization pattern is consistent with its functional role in sperm motility and hyperactivation. Importantly, when conducting immunolocalization studies, researchers should include appropriate knockout controls, as some antibodies may show nonspecific staining in the sperm head that persists even in CatSper4−/− mice .

What is the relationship between CATSPER4 and male fertility?

CATSPER4 is essential for male fertility. Male mice lacking functional CATSPER4 (CatSper4−/− mice) are completely infertile when mated with wild-type females, despite exhibiting normal mating behavior. The infertility phenotype results from the inability of CatSper4-null sperm to develop hyperactive motility, which is required for navigating the female reproductive tract and penetrating the egg's protective layers .

How does CATSPER4 contribute to sperm motility?

CATSPER4 is a critical component of the calcium channel complex that regulates calcium influx into the sperm flagellum. Sperm lacking CATSPER4 show initial motility but fail to develop hyperactive motility patterns even under capacitating conditions. Specifically, CatSper4−/− sperm exhibit a significantly reduced maximal bending angle in the midpiece (approximately 49° compared to 92° in wild-type sperm), which severely impairs their ability to generate the vigorous, asymmetrical flagellar beats characteristic of hyperactivated sperm .

What experimental approaches can be used to study CATSPER4 protein interactions within the CatSper complex?

Investigating CATSPER4 protein interactions requires multiple complementary approaches:

  • Co-immunoprecipitation studies: As demonstrated in previous research, epitope-tagged CATSPER proteins can be transiently expressed in heterologous systems (e.g., HEK-293 cells stably expressing CatSper1) followed by immunoprecipitation with specific antibodies to detect protein-protein interactions. Native interactions can be further confirmed using testis membrane preparations from wild-type and knockout mice .

  • Cryo-electron tomography: This advanced imaging technique has been successfully used to visualize the higher-order organization of the CatSper complex in intact mammalian sperm. The technique reveals that CatSper forms long zigzag-rows along sperm flagella, with specific extracellular domains forming a canopy that interconnects to create a zigzag-shaped roof structure .

  • Structured illumination microscopy (SIM): 3D SIM can be employed to visualize the quadrilinear distribution of CatSper components along sperm flagella and to detect alterations in this distribution in various knockout models .

How can researchers effectively generate and validate CATSPER4 knockout models?

Generating reliable CATSPER4 knockout models requires:

  • Strategic targeting: The gene deletion strategy should target functionally critical regions, such as the putative pore region and a portion of the C-terminus, to ensure complete loss of function .

  • Validation methods:

    • Southern blotting and PCR screening to confirm the presence of the mutant gene

    • Western blotting to confirm absence of protein expression

    • Immunocytochemistry to verify loss of protein localization

    • Functional assays to assess changes in calcium influx and sperm motility parameters

  • Control measurements: Researchers should assess basic parameters such as appearance, gross behavior, and survival of knockout animals, as well as female fertility when crossed with wild-type males, to confirm that phenotypes are specifically related to male reproductive function .

What is known about the structural assembly of the CatSper complex, and how does CATSPER4 contribute to this architecture?

The CatSper complex exhibits a sophisticated structural organization:

  • Tetrameric channel formation: CATSPER4, together with CATSPER1, CATSPER2, and CATSPER3, forms the core tetrameric channel. Fitting of atomic models of isolated monomeric CatSper to in situ maps reveals supramolecular interactions and assembly patterns .

  • Extracellular architecture: Above each tetrameric channel pore, most of the extracellular domains form a canopy structure that interconnects to create a zigzag-shaped roof. In mouse CatSper, an additional wing structure connects to the tetrameric channel .

  • Intracellular organization: The intracellular domains link two neighboring channels to form a diagonal array, suggesting dimer formation between adjacent channels .

  • Species-specific differences: Murine CatSper contains additional structural elements compared to human CatSper, suggesting species-specific adaptations of the complex .

Structural ComponentMouse CatSperHuman CatSperFunctional Implication
Core channel tetramerPresentPresentEssential for ion conduction
Extracellular canopyPresentPresentChannel stabilization and regulation
Zigzag-shaped roofPresentPresentInterconnection of channel units
Wing structurePresentAbsentPotential species-specific regulation
Intracellular diagonal arraysPresentPresentInter-channel communication

What controls are essential when designing experiments to study CATSPER4 function?

When designing experiments to study CATSPER4 function, researchers should implement the following controls:

  • Genetic controls: Include wild-type, heterozygous, and homozygous knockout animals to establish clear genotype-phenotype relationships .

  • Antibody specificity controls: Always validate antibody specificity using tissues/cells from knockout animals to distinguish between specific and non-specific signals .

  • Temporal controls: For motility studies, track sperm function over extended time periods (30+ minutes) to capture the late effects of CatSper deletion on progressive motility .

  • Environmental controls: When assessing hyperactivation, test sperm under both standard and capacitating conditions, as well as in media with different viscosities to mimic physiological environments .

  • Cross-validation: Confirm observed phenotypes using multiple independent methods (e.g., genetic, pharmacological, and biophysical approaches) .

How can researchers effectively measure CatSper-mediated calcium currents in sperm expressing recombinant CATSPER4?

Measuring CatSper-mediated calcium currents presents unique challenges due to the specialized nature of sperm cells. A methodological approach includes:

  • Patch-clamp electrophysiology: This technique allows direct measurement of CatSper currents (ICatSper). The whole-cell patch-clamp configuration can be used to record currents from the sperm principal piece .

  • Alkalization protocols: Since CatSper channels are activated by intracellular alkalization, experimental protocols should include pH manipulation to stimulate channel opening .

  • Calcium imaging: Complementary to electrophysiology, calcium-sensitive fluorescent dyes can be used to monitor intracellular calcium changes in response to various stimuli .

  • Heterologous expression systems: While challenging due to the complex nature of the CatSper channel, researchers can attempt to reconstitute functional channels by co-expressing all four CatSper proteins and necessary auxiliary subunits in mammalian cell lines .

  • Data analysis considerations: Current measurements should consider the unique morphology of sperm cells when normalizing and interpreting results. Cell capacitance and access resistance must be carefully monitored throughout experiments .

What are the methodological considerations for studying CATSPER4 interactions with auxiliary proteins?

Studying CATSPER4 interactions with auxiliary proteins requires:

  • Protein complex isolation: Optimize membrane solubilization conditions to preserve native protein-protein interactions while efficiently extracting the complex from sperm membranes .

  • Sequential co-immunoprecipitation: Use antibodies against different components of the complex in sequential immunoprecipitation steps to identify direct versus indirect interactions .

  • Mass spectrometry analysis: Apply quantitative proteomics approaches to identify novel interaction partners, as demonstrated in studies that identified SLCO6C1, C2CD6, and TRIM69 as potential CatSper-associated proteins .

  • Validation in knockout models: Compare protein levels of candidate interacting partners in wild-type versus Catsper1−/− and Efcab9−/− sperm using western blot analyses to determine dependency relationships .

  • Localization studies: Employ fluorescence microscopy and 3D structured illumination microscopy to assess colocalization of CATSPER4 with candidate interacting proteins along the flagellar quadrants .

How should researchers analyze and interpret motility defects in CATSPER4-deficient sperm?

Analysis of motility defects requires:

  • Quantitative parameters: Measure specific parameters including:

    • Percentage of motile sperm

    • Progressive velocity

    • Path straightness

    • Maximal bending angle in the midpiece (relative to 0° straight)

    • Frequency and amplitude of flagellar beats

  • Temporal dynamics: Track changes in motility patterns over time (0-90+ minutes) under capacitating conditions to distinguish between initial motility and hyperactivation defects .

  • Environmental testing: Assess motility in media of different viscosities to evaluate performance under physiologically relevant conditions that sperm would encounter in the female reproductive tract .

  • Comparative analysis: Present data for mutant sperm alongside wild-type controls analyzed in parallel experiments. For example:

Motility ParameterWild-typeCatSper4−/−Statistical Significance
Motile sperm (%) at 90 min65%36%p < 0.01
Progressive velocity (μm/s)12075p < 0.01
Maximal bending angle (°)9249p < 0.001
  • Visual documentation: Supplement quantitative data with representative video recordings of sperm motility patterns to illustrate qualitative differences .

What are the potential pitfalls in interpreting genetic data from CATSPER4 knockout studies?

When interpreting genetic data from CATSPER4 knockout studies, researchers should be aware of:

  • Interdependence of CatSper subunits: Deletion of any single CatSper subunit can affect the expression and localization of other subunits, making it difficult to attribute phenotypes specifically to the deleted protein versus secondary effects on the entire complex .

  • Compensatory mechanisms: Potential upregulation of other calcium channels or signaling pathways in response to CATSPER4 deletion could mask or modify phenotypes .

  • Strain-specific effects: Genetic background can influence the severity of reproductive phenotypes, necessitating backcrossing to consistent genetic backgrounds for reliable comparisons .

  • Development versus acute function: Distinguishing between developmental roles of CATSPER4 during spermatogenesis versus its acute functions in mature sperm requires careful experimental design, potentially including conditional knockout models .

  • Translation to human fertility: Extrapolating findings from mouse models to human fertility requires caution, as species-specific differences exist in CatSper structure and potentially in function .

What are the emerging approaches for studying CATSPER4 structure-function relationships?

Advanced approaches for investigating CATSPER4 structure-function relationships include:

  • Cryo-EM of isolated channels: Building on the recent success in visualizing the higher-order organization of native CatSper complexes, high-resolution cryo-EM of purified channels could reveal atomic details of CATSPER4's contribution to pore formation and gating mechanisms .

  • Site-directed mutagenesis: Targeted mutations of conserved residues can identify critical domains for channel assembly, ion selectivity, and regulation by intracellular factors .

  • Optogenetic tools: Development of light-sensitive CatSper variants could enable precise temporal control of channel activity to dissect its role in different phases of sperm function .

  • Super-resolution imaging: Further application of advanced microscopy techniques can reveal dynamic changes in CATSPER4 distribution and interactions during capacitation and hyperactivation .

  • Computational modeling: Integration of structural data with computational approaches can predict conformational changes and functional interactions within the CatSper complex .

What is the potential for developing targeted modulators of CATSPER4 function for research applications?

Development of CATSPER4-specific modulators would advance research through:

  • Pharmacological tools: Identification of subunit-specific inhibitors or activators would allow acute manipulation of CATSPER4 function without genetic modification, enabling studies of its real-time role in sperm physiology .

  • Allosteric modulators: Compounds targeting regulatory sites rather than the pore could provide more subtle manipulation of channel gating or calcium permeation .

  • Interaction disruptors: Small molecules or peptides designed to interfere with specific protein-protein interactions within the CatSper complex could help dissect the functional importance of these associations .

  • High-throughput screening approaches: Development of cell-based assays suitable for screening compound libraries could accelerate discovery of CATSPER4 modulators .

  • Structure-guided design: As more detailed structural information becomes available, rational design of CATSPER4-specific compounds becomes increasingly feasible .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.