Recombinant Human CD82 antigen (CD82)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

Recombinant Human CD82 (UniProt ID: P27701-1) is a tetraspanin family protein expressed in systems like HEK293 or Wheat Germ. It plays critical roles in:

  • Metastasis suppression: Downregulation correlates with advanced cancers and metastatic potential .

  • Immune modulation: Regulates phagosome maturation in tuberculosis (TB) pathogenesis and TLR4-mediated inflammatory responses .

  • Angiogenesis control: Inhibits endothelial cell migration via lipid raft clustering and adhesion molecule trafficking .

Key Features of Recombinant CD82:

ParameterDetailsSource
Amino Acid RangeGly111-Leu228 (HEK293) ; Full-length 1-267 (Wheat Germ)
Molecular MassPredicted: 15 kDa; Observed: 25–33 kDa (glycosylation-dependent)
TagsC-terminal polyhistidine (HEK293)
Purity>90% (SDS-PAGE)

Metastasis Suppression

  • Mechanism: Interacts with integrins (α4, α6, β1) and CD44 to inhibit cell migration .

  • Renal Cell Carcinoma (RCC):

    • CD82 mRNA levels are significantly lower in RCC tissues vs. normal tissues (p < 0.05) .

    • Overexpression reduces RCC cell migration by 40–60% (p < 0.05) .

Tuberculosis Pathogenesis

  • Virulence Mechanism: Hypomethylation of the CD82 promoter in Mycobacterium tuberculosis (MTB) enhances phagosome arrest via Rab5/22 interaction, promoting bacterial survival .

  • Clinical Relevance: Elevated CD82/RUNX1 levels in TB granulomas correlate with disease severity .

Angiogenesis Regulation

  • Endothelial Cells: CD82 knockout increases EC migration (2–3 fold) and invasion via upregulated FAK/Src-p130CAS signaling .

  • Therapeutic Target: CD82 sequesters VEGFA/PDGFB to inhibit pathological angiogenesis .

Muscle Regeneration

  • Stem Cell Activation: CD82+ myogenic progenitors show enhanced differentiation into insulin-secreting β cells and muscle fibers .

Antibody Development

Antibody CloneApplicationsKey FindingsSource
CD82 (D7G6H)WB, IHCDetects endogenous CD82 (30–60 kDa)
FAB4616A (APC)Flow CytometryLabels CD82+ lymphocytes and stem cells
AAV2/9-Cd82Gene TherapyImproves optic nerve axonal transport

Disease Models

ModelKey FindingsSource
TB GranulomasCD82↑ correlates with phagosome arrest
RCC MetastasisCD82↓ linked to advanced tumor stage
Dystrophic MuscleCD82 loss impairs myofiber repair

Research Limitations and Future Directions

  • Functional Variability: Glycosylation and splice variants impact CD82 activity across cell types .

  • Therapeutic Potential: CD82-based gene therapy (e.g., AAV2/9 vectors) shows promise in neurodegenerative and metabolic diseases .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
CD82; KAI1; SAR2; ST6; TSPAN27; CD82 antigen; C33 antigen; IA4; Inducible membrane protein R2; Metastasis suppressor Kangai-1; Suppressor of tumorigenicity 6 protein; Tetraspanin-27; Tspan-27; CD antigen CD82
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFI GVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGI VTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKG EEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAI IELLGMVLSICLCRHVHSEDYSKVPKY
Uniprot No.

Target Background

Function
CD82 associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.
Gene References Into Functions
  1. Lower CD82 expression is associated with Biochemical Failure in Prostate cancer. PMID: 29936782
  2. Inhibition of miR-338-5p suppressed the growth and metastasis of A375 cells. CD82 mRNA was identified as a direct target mRNA of miR-338-5p. PMID: 29710538
  3. The positive expression rates of KAI1 and nm23 were significantly lower in laryngeal squamous cell carcinoma than normal laryngeal mucosa. PMID: 29187211
  4. These data propose a mechanism where CD82 membrane organization regulates sustained PKCalpha signaling, resulting in an aggressive leukemia phenotype. These observations suggest that the CD82 scaffold may be a potential therapeutic target for attenuating aberrant signal transduction in acute myeloid leukemia (AML). PMID: 27417454
  5. CD82 is a component of the promiscuous TIMP-1 interacting protein complex on the cell surface of human pancreatic adenocarcinoma cells. CD82 directly binds to the TIMP-1 N-terminal region through its large extracellular loop and co-localizes with TIMP-1. PMID: 28030805
  6. The results suggest that CD82 suppresses epithelial-to-mesenchymal transition in prostate cancer cells adhered to the fibronectin matrix by repressing adhesion signaling through lateral interactions with the associated alpha3beta1 and alpha5beta1 integrins, leading to reduced cell migration and invasive capacities. PMID: 27926483
  7. Overexpression of LAMC2 and knockdown of CD82 markedly promoted GC cell invasion and activated EGFR/ERK1/2-MMP7 signaling via upregulation of the expression of phosphorylated (p)-EGFR, p-ERK1/2, and MMP7. PMID: 28252644
  8. Authors showed that miR-K6-5p directly targeted the coding sequence of the CD82 molecule (CD82), a metastasis suppressor. PMID: 28534512
  9. A sub-population of DeltaNp63 and CD82-positive cells, whose disruption significantly perturbs the development of prostate metastatic tumor growth. PMID: 28368419
  10. These findings uncovered a previously unappreciated function of CD82 in severing the linkage between U2AF2-mediated CD44 alternative splicing and cancer aggressiveness, with potential prognostic and therapeutic implications in melanoma. PMID: 27041584
  11. A mechanism where the membrane organization of CD82, through specific posttranslational modifications, regulates N-cadherin clustering and membrane density, which impacts the in vivo trafficking of AML cells. PMID: 26592446
  12. Methylation of CpG islands within the KAI1 promoter region was observed in the low KAI1-expressing prostate cancer cells. PMID: 27813113
  13. CD82 function may be crucial for muscle stem cell function in muscular disorders. PMID: 27641304
  14. The overexpression of KAI1/CD82 inhibited the proliferation and invasion of OSCC-15 cells. PMID: 28260006
  15. Our present work suggests that CD82 on EC is a potential target for anti-angiogenic therapy in VEGFR2-dependent tumor angiogenesis. PMID: 27103437
  16. That a loss of KAI1/CD82 and an increase in PDGFR expression in gliomas relate to progressive tumor growth. PMID: 27764516
  17. KAI1 underexpression is associated with gastric cancer. PMID: 27793161
  18. KAI1-induced decreases in VEGFC expression are mediated via Src/STAT3 signaling pathways in pancreatic cancer cells. PMID: 27082851
  19. The simultaneous overexpression of p12CDK2-AP1 and CD82 significantly suppressed in vivo tumor growth. PMID: 27349208
  20. Lack of expression of KAI1 might indicate a more aggressive form of breast cancer. PMID: 27509988
  21. KAI1 and KISS1 are implicated in the pathogenesis and maintenance of endometriosis. PMID: 26918694
  22. Ubiquitously expressed CD82 restrains cell migration and invasion by modulating both cell-matrix and cell-cell adhesiveness and confining outside-in pro-motility signaling. PMID: 26335499
  23. Survivin, Bcl-2, and KAI1 are metastasis-related factors in cervical cancer. Overexpression of survivin and Bcl-2, and low expression of KAI1 promote cervical cancer progress and metastasis. PMID: 26681053
  24. KAI1 was able to suppress melanoma angiogenesis by downregulating IL-6 and VEGF expression. PMID: 26199094
  25. Loss of both KAI1 and p27 defines a subgroup of primary melanoma patients with poor prognosis. PMID: 26246476
  26. The expression of KAI1/CD82, CD44, MMP7, and beta-catenin is related to tumor metastasis and prognosis in colorectal carcinoma. PMID: 26408312
  27. Serum-free media and hypoxia protected MiaPaCa-2 cells from KAI1-induced apoptosis and proliferation inhibition via autophagy induction. PMID: 25199507
  28. High KAI1 expression is associated with epithelial-mesenchymal transition in non-small cell lung cancer. PMID: 26231404
  29. CD82 regulated BCL2L12 expression via STAT5A and AKT signaling and stimulated the proliferation and engrafting of leukemia cells. PMID: 26260387
  30. CD82 enhanced the expression of miR-203 and directly downregulated FZD2 expression, suppressing cancer metastasis/cell migration by inhibiting the Wnt signaling pathway. PMID: 26132195
  31. Blockade of CD82 in leukemia cells lowered EZH2 expression via activation of p38 MAPK signaling. PMID: 25955299
  32. KAI1-splice not only counteracts the tumor-suppressive actions of KAI1 but - beyond that - promotes alphavbeta3-mediated biological functions in favor of tumor progression and metastasis. PMID: 25435431
  33. CD82 down-regulation could be a critical step involved in the EGFR over-expression and the stronger tumorigenic activity triggered by EGFR mutations. PMID: 25912735
  34. These results suggested that microRNA-362-3p or CD82 can be exploited as a new potential target for the control of gastric cancers in the future. PMID: 25652145
  35. The expression level of KAI1 was downregulated, while the expression level of VEGF was upregulated in the tissues or serum of patients with hepatocellular carcinoma. Combined detection of KAI1 and VEGF forms a reliable panel of diagnostic markers for HCC. PMID: 25071074
  36. Hypermethylation of the CD82 promoter may be an event leading to the development of hepatoma and is likely to be involved in tumor progression. PMID: 25119390
  37. High expression of COX-2 and low expression of KAI-1/CD82 are associated with increased tumor invasiveness in papillary thyroid carcinoma. PMID: 23617728
  38. KAI-1, might be an important biological marker involved in the carcinogenesis, metastasis, and invasion of gallbladder adenocarcinoma. PMID: 25688501
  39. This study reveals that DeltaNp63alpha upregulates CD82 to inhibit cell invasion, and suggests that GSK3beta can regulate cell invasion by modulating the DeltaNp63alpha-CD82 axis. PMID: 24901051
  40. Low CD82 expression is associated with laryngeal squamous cell carcinoma. PMID: 24758564
  41. CD82 overexpression increases the molecular density of alpha4 within membrane clusters, thereby increasing cellular adhesion. PMID: 24623721
  42. Clear cell renal cell carcinoma patients with CD82 positive expression show poor prognosis. PMID: 24553302
  43. CD82/KAI expression prevents IL-8-mediated endothelial gap formation in late-stage melanomas. PMID: 23873025
  44. Positive expression of KAI1 protein was found in ovarian tissue in 72.2% cases in BRCA1 mutation carriers and in 72.2 % in the control group. PMID: 23553196
  45. Taken together, these data suggest that anti-miR-197 suppresses HCC migration and invasion by targeting CD82. PMID: 24613834
  46. No statistically significant association was observed in KAI1 exon 9. PMID: 23873015
  47. KAI1 overexpression increases ING4 expression. Decreased KAI1 expression correlated with worse melanoma patient survival. Increased expression of KAI1 reduces melanoma cell migration. PMID: 24130172
  48. An important new insight into the modulatory role of CD82 in endocytic trafficking of the EGF receptor. PMID: 23897813
  49. KAI1/CD82 and cyclinD1 may serve as markers for the determination of invasiveness, metastasis, and prognosis of laryngeal squamous cell carcinoma. PMID: 23696923
  50. Our data suggest that the CD82/STAT5/IL-10 signaling pathway is involved in the survival of CD34(+)/CD38(-)acute myelogenous leukemia cells. PMID: 23797738

Show More

Hide All

Database Links

HGNC: 6210

OMIM: 600623

KEGG: hsa:3732

STRING: 9606.ENSP00000227155

UniGene: Hs.527778

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Lymphoid specific.

Q&A

What is CD82 and what are its basic structural characteristics?

CD82 (also known as KAI-1) is a tetraspanin family membrane protein that plays crucial roles in cell adhesion, migration, and signaling. The mature human CD82 protein consists of 267 amino acids with a predicted molecular mass of approximately 15 kDa, though glycosylation increases its apparent molecular mass to 25-33 kDa in SDS-PAGE analysis . The protein contains four transmembrane domains, forming a characteristic tetraspanin structure with intracellular N- and C-termini, and two extracellular loops. The large extracellular loop (LEL) mediates most protein-protein interactions and contains most of the glycosylation sites.

When working with recombinant forms, researchers commonly use fragments containing the functionally important regions, such as the Gly111-Leu228 segment that includes portions of the LEL .

How does CD82 expression vary across different cell types?

CD82 is expressed on various cell types, including immune cells (particularly T lymphocytes), epithelial cells, and certain stem/progenitor populations. Expression levels are dynamically regulated in different physiological and pathological contexts:

  • Immune cells: CD82 is constitutively expressed on resting T cells but significantly upregulated (up to 5-fold in CD8+ T cells and 9-fold in CD4+ T cells) following TCR activation and IL-2 stimulation .

  • Cancer cells: CD82 expression is frequently downregulated in metastatic cancer tissues compared to primary tumors or normal tissues, consistent with its role as a metastasis suppressor .

  • Developmental contexts: CD82 expression marks specific progenitor populations, such as pancreatic β-cell precursors, where it can serve as a selection marker for cell isolation .

When designing experiments, researchers should consider these tissue-specific and context-dependent expression patterns to accurately interpret results.

What are the primary biological functions of CD82?

CD82 functions as a molecular organizer within the plasma membrane, influencing multiple cellular processes:

  • Immune cell regulation: CD82 enhances T-cell activation, cytokine production (particularly IFN-γ, TNF-α, and IL-2), and memory subset accumulation .

  • Metastasis suppression: CD82 inhibits cell migration and invasion by regulating integrin-dependent adhesion, membrane organization, and cytoskeletal dynamics .

  • Cell differentiation: CD82 contributes to the maturation of certain progenitor populations, such as pancreatic β-cell precursors into insulin-producing cells .

  • Membrane organization: CD82 modulates membrane mechanics, affects caveolae integrity, and influences stress fiber formation, focal adhesions, and mechanotransduction pathways .

These diverse functions make CD82 relevant to multiple research fields, including immunology, oncology, and developmental biology.

How does CD82 influence T-cell activation and function?

CD82 plays multifaceted roles in T-cell biology, functioning as both a marker and modulator of activation:

  • Activation marker: CD82 expression increases substantially following TCR stimulation, with up to 9-fold increases in CD4+ T cells and 5-fold increases in CD8+ T cells, making it a reliable activation indicator .

  • Co-stimulatory function: CD82 can function as a co-stimulatory molecule analogous to CD28. When T cells are stimulated with anti-CD3 in combination with anti-CD82 antibodies, they exhibit enhanced activation compared to anti-CD3 alone .

  • Cytokine production: T cells with high CD82 expression (CD82high) produce significantly higher levels of cytotoxic cytokines compared to CD82low cells:

    • IFN-γ: ~900 pg/mL in CD82high vs. minimal in CD82low cells

    • TNF-α: ~2000 pg/mL in CD82high vs. ~150 pg/mL in CD82low cells

  • IL-2 regulation: CD82 co-stimulation promotes sustained IL-2 production in CD4+ T cells over 72 hours, with a steeper production curve than even CD28 co-stimulation .

  • Memory cell differentiation: CD82high T cells more efficiently differentiate from naive to central memory phenotypes. In CD82high populations, the naive subset (CCR7+/CD45RA+) decreases to 7-10% while the central memory subset (CCR7+/CD45RA-) increases to 70-80% .

For immunological research, these findings suggest CD82 could be targeted to enhance T-cell responses in immunotherapy approaches.

What methodologies are recommended for studying CD82's role in cytotoxic T-cell function?

When investigating CD82's impact on cytotoxic T-cell function, consider these methodological approaches:

  • Cell sorting strategies: Sort T cells into CD82high and CD82low populations using flow cytometry, then compare their functional properties. For optimal results, sort cells after 2 days of IL-2R stimulation and anti-CD3/28 activation .

  • Cytotoxicity assays: Co-culture CD82-expressing T cells with target cells and measure cytolysis using real-time imaging or flow cytometry-based assays. CD8+ T cells overexpressing CD82 can achieve up to 80% target cell cytolysis by 36 hours .

  • Cytokine profiling: Measure cytokine secretion using ELISA following TCR stimulation. Compare supernatants from CD82high and CD82low T cells to assess differences in IFN-γ, TNF-α, and other effector molecules .

  • Co-stimulation experiments: Compare T-cell responses to anti-CD3 alone versus anti-CD3 plus anti-CD82 antibodies (5 μg/mL) to evaluate CD82's co-stimulatory potential. Include anti-CD28 as a positive control .

  • Memory subset analysis: Use flow cytometry with CCR7 and CD45RA markers to track changes in naive (CCR7+/CD45RA+), central memory (CCR7+/CD45RA-), and effector memory (CCR7-/CD45RA-) subsets over time (7-day culture recommended) .

When designing these experiments, standardize stimulation conditions (anti-CD3 concentration: 0.5 μg/mL; IL-2 supplementation) to ensure reproducibility.

How does CD82 function as a metastasis suppressor?

CD82 (KAI-1) has been extensively characterized as a metastasis suppressor, with multiple mechanisms contributing to this function:

  • Cell migration inhibition: CD82 overexpression significantly reduces cell motility and migratory capacity, as demonstrated in trophoblast and various cancer cell models . This occurs through:

    • Regulation of integrin-dependent adhesion

    • Modulation of cell membrane organization

    • Alteration of cytoskeletal dynamics

  • ECM remodeling regulation: CD82 influences the gelatinolytic activities of matrix metalloproteinases (MMPs), enzymes crucial for degrading extracellular matrix components during invasion .

  • Membrane mechanics modulation: CD82 affects fundamental membrane properties by:

    • Regulating stress fiber formation

    • Controlling focal adhesion dynamics

    • Influencing caveolae integrity

    • Modulating membrane tension

    • Affecting YAP nuclear translocation in a caveolin-1-dependent manner

  • Signaling pathway interference: CD82 interacts with and modulates multiple signaling pathways implicated in metastasis, including:

    • EGFR-mediated signaling

    • Integrin-dependent pathways

    • Mechanotransduction cascades involving YAP/TAZ

Loss of CD82 expression is frequently observed in advanced stages of multiple cancer types, including breast cancer, correlating with increased metastatic potential .

What experimental models are most appropriate for studying CD82's anti-metastatic properties?

When investigating CD82's anti-metastatic functions, consider these experimental models and approaches:

  • 2D migration assays: Track single-cell trajectories using time-lapse microscopy in CD82-overexpressing versus control cells. EGF stimulation can be used to trigger migration .

  • 3D invasion models: Use transwell chambers coated with Matrigel or collagen to assess invasive capacity. Compare invasion rates between CD82-manipulated and control cells, quantifying the number of cells crossing the matrix barrier .

  • Cell line models: Several well-characterized cell lines are suitable for CD82 metastasis studies:

    • HTR8/SVneo (trophoblast cells) - well-established for studying CD82's effects on migration and invasion

    • Breast cancer cell lines (MCF-7, MDA-MB-231) - frequently used due to CD82's relevance in breast cancer progression

    • Prostate cancer cell lines - where CD82 was initially identified as a metastasis suppressor

  • Mechanistic studies: To understand the molecular basis of CD82's effects:

    • Visualize focal adhesions using Talin-GFP labeling in CD82-expressing cells

    • Track YAP nuclear localization through immunofluorescence

    • Monitor actin cytoskeleton organization with phalloidin staining

    • Assess caveolae integrity using electron microscopy or caveolin-1 immunostaining

  • In vivo metastasis models: For translational relevance, use mouse models with CD82-manipulated cancer cells to assess:

    • Primary tumor growth

    • Metastatic spread

    • Target organ colonization

These complementary approaches provide a comprehensive assessment of CD82's role in the metastatic cascade.

What role does CD82 play in progenitor cell differentiation?

CD82 has emerged as an important regulator of stem and progenitor cell differentiation, particularly in the context of pancreatic β-cell development:

  • Progenitor cell marker: CD82 serves as a surface marker for isolating specific progenitor populations. In pancreatic differentiation, CD82 expression identifies late-stage pancreatic progenitor cells with enhanced potential to differentiate into endocrine cells .

  • Functional contribution: Beyond its utility as a marker, CD82 actively contributes to differentiation processes:

    • CD82+ progenitor cells show superior insulin secretion capacity compared to CD82- cells

    • Knockdown of CD82 impairs β-cell function, indicating its functional role in maturation

    • CD82 likely influences membrane organization and signaling pathways critical for differentiation

  • Developmental dynamics: CD82 expression changes dynamically during differentiation, with stage-specific patterns that reflect developmental progression. Flow cytometric analysis reveals distinct CD82 expression profiles at different stages (day 7, day 12, and day 22) of pancreatic differentiation .

These findings have significant implications for regenerative medicine approaches, particularly for generating functional β-cells for diabetes treatment.

How can CD82 be utilized to improve progenitor cell isolation and differentiation protocols?

Researchers can leverage CD82 to enhance stem cell differentiation protocols through these approaches:

  • Positive selection strategy: Use fluorescence-activated cell sorting (FACS) or magnetic-activated cell sorting (MACS) with anti-CD82 antibodies to enrich for progenitor populations with enhanced differentiation potential. This approach has been successfully applied to isolate β-cell precursors from mixed populations .

  • Quality control marker: Monitor CD82 expression during differentiation protocols as an indicator of proper progression. Flow cytometric analysis at key timepoints can help identify successful versus suboptimal differentiation.

  • Differentiation enhancement: Consider manipulating CD82 expression or function to improve differentiation outcomes:

    • CD82 overexpression might enhance differentiation efficiency

    • CD82-activating antibodies could potentially stimulate differentiation pathways

    • Targeting CD82-associated signaling could optimize progenitor maturation

  • Purity assessment: Use immunofluorescence staining of clusters derived from CD82+ versus CD82- sorted cells to compare differentiation outcomes. Look for co-expression of CD82 with lineage-specific markers .

  • Functional readouts: Evaluate the functional superiority of CD82-selected cells through:

    • Glucose-stimulated insulin secretion assays

    • Calcium imaging to assess stimulus-secretion coupling

    • Transcriptional profiling of maturation markers

These strategies can help address a major challenge in regenerative medicine: generating homogeneous, functional cell populations from pluripotent stem cells.

What are the recommended protocols for manipulating CD82 expression in research models?

Effective manipulation of CD82 expression is crucial for investigating its functions. Consider these methodological approaches:

CD82 Overexpression

  • Vector selection: For membrane protein expression, vectors with CMV or EF1α promoters provide robust expression. Include epitope tags (FLAG, HA) at the C-terminus to avoid interfering with membrane insertion .

  • Verification methods:

    • Immunocytochemistry using anti-FLAG/tag antibodies to confirm proper membrane localization

    • Western blotting to detect the expected molecular weight patterns (typically 25-33 kDa due to glycosylation)

    • Flow cytometry to quantify surface expression levels

  • Expression considerations: After CD82 overexpression, an additional band at ~55 kDa may appear in Western blots, likely representing a different glycosylation form .

CD82 Knockdown/Knockout

  • siRNA approach: For transient knockdown, use specific siRNAs targeting CD82 mRNA. Validate knockdown efficiency by Western blot and flow cytometry .

  • shRNA approach: For stable knockdown, lentiviral delivery of shRNAs provides longer-term suppression.

  • CRISPR/Cas9: For complete knockout, design gRNAs targeting early exons of CD82. Confirm knockout by sequencing and absence of protein expression.

Cell Sorting Strategy

To study cells with different CD82 expression levels:

  • Stimulate T cells with IL-2 and anti-CD3/28 for 2 days

  • Sort into CD82highCD81high and CD82lowCD81low populations

  • Culture sorted cells with continued IL-2 supplementation

  • Validate sustained expression differences after sorting

These approaches provide complementary strategies to investigate CD82 function through gain-of-function and loss-of-function experiments.

What are the critical considerations when working with recombinant CD82 protein?

When utilizing recombinant CD82 protein in research applications, consider these important factors:

Protein Characteristics

  • Domain selection: Most commercially available recombinant CD82 proteins contain partial sequences focusing on the functionally important large extracellular loop (LEL), such as Gly111-Leu228 .

  • Expression system: Human cell lines (e.g., HEK293) are preferred for producing properly folded and glycosylated CD82, as glycosylation affects protein function .

  • Tags and fusion partners: C-terminal His-tags are commonly used and generally don't interfere with function. Consider the impact of tag position and size on structural integrity and activity .

  • Molecular weight considerations: While the predicted molecular mass of the core protein may be 15 kDa, expect 25-33 kDa bands in SDS-PAGE due to glycosylation .

Storage and Handling

  • Reconstitution: Reconstitute lyophilized protein in sterile water to a stock concentration of 0.2 μg/μl. Centrifuge the vial at 4°C before opening to recover all content .

  • Storage conditions: Store at -20°C to -80°C under sterile conditions. Aliquot to avoid repeated freeze-thaw cycles that can compromise protein integrity .

  • Stability: Properly stored samples typically remain stable for twelve months from the date of receipt .

Quality Control Parameters

  • Purity: Verify >90% purity by SDS-PAGE before experimental use .

  • Endotoxin levels: Ensure <1.0 EU per μg of protein as determined by the LAL method to prevent experimental artifacts from endotoxin contamination .

  • Functional validation: Confirm biological activity through binding assays or cell-based functional tests appropriate to your experimental context.

These considerations help ensure experimental reproducibility and reliable results when working with recombinant CD82 protein.

How might CD82 be leveraged for immunotherapeutic approaches?

CD82's multiple functions in T-cell biology suggest several promising immunotherapeutic applications:

  • Enhanced T-cell activation: CD82's co-stimulatory properties could be exploited to boost T-cell responses in cancer immunotherapy:

    • Anti-CD82 agonistic antibodies could provide co-stimulation alongside TCR engagement

    • CD82 overexpression in CAR-T cells might enhance their cytotoxic potential

    • CD82-targeting approaches could sustain IL-2 production, supporting T-cell persistence

  • Memory T-cell generation: CD82high T cells show enhanced differentiation toward central memory phenotypes, which are associated with improved long-term anti-tumor responses:

    • Selecting or engineering CD82high T cells might improve the persistence of adoptive cell therapies

    • Modulators of CD82 expression could potentially enhance memory formation during vaccination

  • Cytotoxic function enhancement: CD82 overexpression significantly impacts cytolytic activity against target cells:

    • CD8+ T cells overexpressing CD82 achieve up to 80% target cell cytolysis at 36 hours

    • CD4+ T cells with CD82 overexpression demonstrate approximately 40% target cell cytolysis

  • Combination approaches: CD82-targeting could complement existing immunotherapies:

    • Checkpoint inhibitors might synergize with CD82 agonists

    • Cytokine therapies could be optimized by CD82 modulation

These approaches would require careful validation in preclinical models before clinical translation, but the significant effects of CD82 on T-cell function suggest therapeutic potential.

What are the unresolved questions and contradictions in CD82 research?

Despite significant advances, several important questions about CD82 remain unresolved:

  • Mechanistic uncertainties:

    • The precise molecular mechanisms by which CD82 organizes membrane microdomains and influences receptor clustering remain incompletely understood

    • How CD82 coordinates its diverse functions across different cell types (immune cells, epithelial cells, progenitors) is unclear

    • The relationship between CD82's anti-metastatic and immunomodulatory functions has not been fully explored

  • Functional contradictions:

    • While CD82 generally suppresses cell migration, its role in enhancing T-cell activation seems paradoxical since activated T cells must migrate to sites of inflammation

    • CD82 appears to have context-dependent effects on signaling pathways, sometimes enhancing and sometimes suppressing the same pathway in different cell types

    • The relative importance of CD82's scaffolding function versus direct signaling capabilities remains debated

  • Regulatory gaps:

    • Factors controlling CD82 expression in different contexts are not completely mapped

    • Post-translational modifications affecting CD82 function, particularly different glycosylation patterns, need further characterization

    • The significance of CD82 internalization and recycling dynamics to its function requires additional investigation

  • Therapeutic translation challenges:

    • Whether CD82-targeting approaches can selectively affect specific cell populations without unwanted effects on other CD82-expressing cells

    • The potential for CD82-mediated immunomodulation to overcome immunosuppressive tumor microenvironments

  • Interaction complexity:

    • CD82 interacts with multiple partners including other tetraspanins, integrins, and signaling receptors, forming a complex "tetraspanin web" whose composition and function vary by context

Addressing these questions will require integrated approaches combining structural biology, advanced imaging, proteomics, and in vivo models to fully unravel CD82's multifaceted biology.

What advanced techniques are emerging for studying CD82's membrane organization functions?

Cutting-edge technologies are enabling deeper insights into CD82's membrane organizing functions:

  • Super-resolution microscopy techniques:

    • Single-molecule localization microscopy (PALM/STORM) can visualize CD82 nanoclusters with 10-20 nm resolution

    • Stimulated emission depletion (STED) microscopy allows visualization of dynamic CD82 interactions with partner proteins

    • These approaches overcome the diffraction limit of conventional microscopy to reveal CD82's true membrane organization

  • Proximity labeling proteomics:

    • BioID or APEX2 fusion proteins can identify proteins in close proximity to CD82 in living cells

    • This reveals the dynamic CD82 "interactome" in different cellular contexts and activation states

    • Quantitative comparative analysis can show how CD82's interaction network changes during processes like T-cell activation

  • Membrane biophysics approaches:

    • Fluorescence recovery after photobleaching (FRAP) measures CD82's effects on membrane fluidity

    • Förster resonance energy transfer (FRET) detects direct molecular interactions between CD82 and partner proteins

    • Atomic force microscopy can measure CD82's effects on membrane mechanical properties

  • Cryo-electron tomography:

    • This technique enables visualization of membrane protein organization in near-native states

    • Can reveal how CD82 influences the three-dimensional architecture of membrane domains

  • Organoid and tissue imaging:

    • Light-sheet microscopy combined with clearing techniques allows visualization of CD82 in complex 3D tissues

    • This bridges the gap between cellular studies and in vivo relevance

These technologies, often used in combination, are revealing unprecedented details about how CD82 organizes the plasma membrane to coordinate diverse cellular functions.

CD82 Expression and T-Cell Function Data

T-Cell ParameterCD81lowCD82low CellsCD81highCD82high CellsFold DifferenceReference
IFN-γ ProductionMinimal~900 pg/mL>50x
TNF-α Production~150 pg/mL~2000 pg/mL~13x
Naive CD4+ T cells (CCR7+/CD45RA+)~40%~7%0.18x
Central Memory CD4+ T cells (CCR7+/CD45RA-)~55%~80%1.45x
Naive CD8+ T cells (CCR7+/CD45RA+)~40%~10%0.25x
Central Memory CD8+ T cells (CCR7+/CD45RA-)~51%~70%1.37x
Target Cell Cytolysis (CD8+ T cells, 36h)Not reported~80%-
Target Cell Cytolysis (CD4+ T cells, 36h)Not reported~40%-

Recombinant Human CD82 Protein Specifications

ParameterSpecificationNotes
Protein LengthGly111-Leu228 (118 amino acids)Contains portions of the large extracellular loop
Expression SystemHEK293Mammalian expression for proper glycosylation
TagC-terminal polyhistidineEnables purification without affecting function
Predicted Molecular Mass15 kDaCore protein without glycosylation
Apparent Molecular Mass25-33 kDaDue to glycosylation
Purity>90%As determined by SDS-PAGE
Endotoxin Level<1.0 EU per μgDetermined by LAL method
Storage Conditions-20°C to -80°CStable for twelve months
ReconstitutionSterile water to 0.2 μg/μlCentrifuge vial before opening

Source:

CD82 in Different Research Applications

Research ApplicationKey FindingsModel SystemsReference
T-Cell ActivationCD82 functions as co-stimulatory molecule; enhances cytokine productionPrimary T cells, IL-2R stimulation
Cell MigrationCD82 inhibits cell movement through membrane mechanics involving caveolin and YAP pathwayHB2 cells with EGF stimulation
Trophoblast InvasionCD82 overexpression inhibits migration and invasionHTR8/SVneo cells
β-Cell DevelopmentCD82 marks progenitors with enhanced differentiation potentialPancreatic progenitor cells
Cancer MetastasisCD82 (KAI-1) downregulation associated with metastatic progressionMultiple cancer types, especially breast cancer

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.