Recombinant Human Adhesion G protein-coupled receptor E5 (ADGRE5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for the specific delivery time.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ADGRE5; CD97; Adhesion G protein-coupled receptor E5; Leukocyte antigen CD97; CD antigen CD97
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
531-835
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
CD97
Target Protein Sequence
SSFAILMAHYDVEDWKLTLITRVGLALSLFCLLLCILTFLLVRPIQGSRTTIHLHLCICL FVGSTIFLAGIENEGGQVGLRCRLVAGLLHYCFLAAFCWMSLEGLELYFLVVRVFQGQGL STRWLCLIGYGVPLLIVGVSAAIYSKGYGRPRYCWLDFEQGFLWSFLGPVTFIILCNAVI FVTTVWKLTQKFSEINPDMKKLKKARALTITAIAQLFLLGCTWVFGLFIFDDRSLVLTYV FTILNCLQGAFLYLLHCLLNKKVREEYRKWACLVAGGSKYSEFTSTTSGTGHNQTRALRA SESGI
Uniprot No.

Target Background

Function
This receptor is potentially involved in both adhesion and signaling processes early after leukocyte activation. It plays a crucial role in leukocyte migration.
Gene References Into Functions
  1. Biochemical features of the adhesion G protein-coupled receptor CD97 related to its auto-proteolysis and HeLa cell attachment activities PMID: 27641734
  2. High CD97 expression Correlates with Breast, Colorectal and Pancreatic Cancer. PMID: 28373465
  3. High expression of CD97 is associated with lymphatic metastasis in gastric cancer. PMID: 26233326
  4. This study indicated that the CD97 and CD55 proteins might be reliable biomarkers to predict the metastasis status and prognosis of intrahepatic cholangiocarcinoma patients. PMID: 28345461
  5. Knock down of CD97 led to an altered mechanical phenotype, reduced adhesion to a stromal layer and lower wildtype FLT3 expression. PMID: 26462154
  6. present study suggested that the expressions of CD97 antigen and decay accelerating factor(DAF) were both upregulated in human cervical squamous cell carcinoma PMID: 26107567
  7. CD97 promotes gastric cancer cell proliferation and invasion in vitro through exosome-mediated MAPK signaling pathway, and exosomal miRNAs are probably involved in activation of the CD97-associated pathway. PMID: 26034356
  8. we identify the specific isoforms of CD97, a novel pro-invasive glioma antigen, across histologic grades of glioma and within BTICs. We also demonstrate a trend towards increased CD97 expression among the classical and mesenchymal GBM subtypes. PMID: 25714433
  9. We conclude that CD97 is located in the SR and at the peripheral sarcolemma of human and murine skeletal muscle, where its absence affects the structure of the SR without impairing skeletal muscle function PMID: 24949957
  10. CD97 enhanced TIMP-2 secretion, leading to reduced MT-MMP-1 and -2 activities, impairing cell migration/invasion in vitro and lung macrometastasis in vivo and upregulating integrins. Both the NTF and the CTF of CD97 were required. PMID: 25174588
  11. These results provide the first experimental evidence that cd97 is a direct target of miR-126. PMID: 24274104
  12. study reports gene expression in skeletal muscle tissue of women with metabolic syndrome is enriched in inflammatory response-related genes; IL6R, HDAC9 and CD97 expression correlated negatively with insulin sensitivity; suggests a role for these 3 inflammatory genes in development of skeletal muscle insulin resistance in women PMID: 23771909
  13. Lysophosphatidylethanolamine utilizes LPA(1) and CD97 in a breast cancer cell line. PMID: 23838008
  14. CD97 expression promotes invasion and migration in glioblastoma multiforme, but has no effect on tumor proliferation. PMID: 23658650
  15. CD97 expression in human thyroid cancers correlated with LPA receptor and markers of aggressiveness including Ki67 and pAKT. PMID: 22797060
  16. CD97 small isoform not only supported gastric cancer local growth, but also promoted metastatic spread in orthotopically implanted mouse model. PMID: 22768192
  17. CD97 and CD55 showed high expression at the invasive front of gallbladder carcinoma. CD97 and CD55 expression was associated with high histologic grade, advanced pathologic T stage, clinical stage and positive venous/lymphatic invasion. PMID: 22547928
  18. binding of leukocytes to activated endothelium mediated by the interaction of CD97 with Thy-1 is involved in firm adhesion of polymorphonuclear cells during inflammation and may play a role in the regulation of leukocyte trafficking to inflammatory sites. PMID: 22210915
  19. we conclude that the possible upregulation of CD97 mediated by WT1 promotes cellular invasiveness-one of the most characteristic and challenging aspects of glial tumor cells. PMID: 22313360
  20. CD97 functioned to mediate invasion in prostate cancer cells, by associating with lysophosphatidic acid receptor 1 (LPAR1), leading to enhanced LPA-dependent RHO and extracellular signal-regulated kinase activation. PMID: 21978933
  21. expression of the wild type - but not the GPS cleavage-deficient CD97 up-regulates the expression of N-cadherin, leading to Ca(++)-dependent cell-cell aggregation. PMID: 21156175
  22. Elevated expression of CD97 and its ligand CD55 at the invasion front correlate with tumor recurrence and metastasis, and CD95 may be a poor prognostic factor for rectal adenocarcinoma. PMID: 20339853
  23. the tumor promoting role of CD97 small isoform in cancer progression PMID: 20428763
  24. complex cellular expression programmes rather than activation modes regulate the expression of EGF-TM7 receptors in macrophages PMID: 20167235
  25. CD97 expression correlates with dedifferentiation, migration, and invasion in colorectal tumor cell lines PMID: 12414513
  26. coengagement of alpha5beta1 and chondroitotin sulfate proteoglycan by CD97 synergistically initiates endothelial cell invasion PMID: 15576472
  27. Findings suggest that CD97(EGF) may play a role in the development and invasion of gastric carcinomas. PMID: 16273233
  28. CD55 engagement with its natural ligand CD97 can act as a potent costimulator of human CD4+ T cells, resulting in cellular activation and promoting enhanced proliferation and cytokine secretion. PMID: 16818763
  29. enhanced CD97 expression in colorectal cancer cells is regulated independent of beta-catenin/Tcf-4, and is thus not a direct target of the canonical Wnt pathway PMID: 16929497
  30. CD55 may simultaneously regulate both the innate and adaptive immune responses and can also regulate complement when bound to CD97. PMID: 17449467
  31. EGF-TM7 pre-mRNAs also undergo the rare trans-splicing, leading to the generation of functional chimeric receptors. PMID: 18267122
  32. Sp1 and Sp3 over-expression activates CD97 promoter activity in HEK293 cells. PMID: 18329191
  33. CD97 is present on all lymphocytes in blood and lymphoid tissue. Expression of CD97 on B cells was lower compared to T and NK cells and did not differ between B-cell subsets. PMID: 19428565
  34. CD97-mFc can adopt two different conformations; one capable of auto-proteolysis and the other not. PMID: 19737555
  35. CD97 is expressed in all types of macrophages and dendritic cells except for microglia, in most T cells but only a few B cells, in smooth muscle cells, and in a restricted set of thyroid and gastrointestinal carcinomas. PMID: 11380941

Show More

Hide All

Database Links

HGNC: 1711

OMIM: 601211

KEGG: hsa:976

STRING: 9606.ENSP00000242786

UniGene: Hs.466039

Protein Families
G-protein coupled receptor 2 family, LN-TM7 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.; [Adhesion G protein-coupled receptor E5 subunit alpha]: Secreted, extracellular space.
Tissue Specificity
Broadly expressed, found on most hematopoietic cells, including activated lymphocytes, monocytes, macrophages, dendritic cells, and granulocytes. Expressed also abundantly by smooth muscle cells. Expressed in thyroid, colorectal, gastric, esophageal and p

Q&A

What is the molecular structure of ADGRE5 and how does it differ from other adhesion GPCRs?

ADGRE5 (CD97) belongs to the adhesion G protein-coupled receptor (aGPCR) family, specifically the ADGRE subfamily formerly classified as EGF-TM7 receptors. The receptor contains:

  • A signal sequence (25 amino acids in humans)

  • An N-terminal extracellular domain (ECD) spanning approximately 377 amino acids

  • Seven transmembrane (TM) regions separated by short intracellular and extracellular loops

The ECD contains a highly glycosylated mucin-like stalk followed by a GPCR proteolytic cleavage site (GPS). Post-translational processing involves cleavage of the 60 kDa N-terminus from the 80 kDa full-length form, which is necessary for efficient cell surface expression. The cleaved portion may remain non-covalently associated with the receptor or be released into the extracellular environment .

Unlike other ADGRE family members that are restricted to immune cells, ADGRE5 shows a broader tissue distribution, making it unique within its subfamily .

What are the known ligands and signaling pathways associated with ADGRE5?

ADGRE5 functions primarily as an adhesion protein with roles in cell adhesion, migration, and signaling. While our understanding of its complete signaling cascade remains incomplete, several important interactions have been identified:

  • Ligand interactions: Tissue transglutaminase (TG2) has been reported as a ligand, and binding inhibits melanoma growth and metastasis .

  • Protein associations: ADGRE5 associates with the tetraspanin CD81, which stabilizes its complex with Gαq/11 for cell signaling .

  • Downstream effects: Activation leads to changes in cell adhesion, with studies showing a 2-4 fold increase in adhesion to human fibronectin when recombinant ADGRE5 is present .

The GPS cleavage is crucial for receptor function, as mutations that impair this process show defective intracellular trafficking and reduced cell surface expression, which has been linked to developmental disorders .

How is ADGRE5 expression distributed across normal tissues?

ADGRE5 shows a distinct expression pattern across tissues as revealed by bulk RNA sequencing and single-cell RNAseq data:

Primary expression sites:

  • Most abundant in bone marrow-derived immune cells across all tissues

  • Moderate expression in smooth and skeletal muscle cells

  • Low to moderate expression in specialized epithelial cells including:

    • Alveolar type 1 (AT1) and AT2 cells

    • Respiratory ciliated cells

    • Gastric mucus-secreting cells

    • Extravillus placental trophoblast cells

Secondary expression sites:

  • Low expression in fibroblasts across nearly all organs

  • Widely distributed but with highest mRNA expression in:

    • Brain

    • Thyroid

    • Skin

    • Female reproductive system

This expression pattern is important to consider when designing experiments, as the bulk ADGRE5 RNA data from both normal and tumor tissues primarily represents ADGRE5 expression in immune cells .

What is the evidence for ADGRE5's role in tumorigenesis?

ADGRE5 shows consistent altered expression across numerous tumor types, suggesting a significant role in cancer biology:

  • Expression patterns: ADGRE5 is induced or noticeably upregulated in many cancers compared to corresponding normal tissues. It was first discovered to be induced in dedifferentiated anaplastic thyroid carcinoma 25 years ago .

  • Tumor cell lines: The majority of tumor-derived cell lines show moderate to high ADGRE5 expression levels. Only 6.4% of 1389 analyzed tumor cell lines had low/negligible expression (log2(TPM + 1) values ≤1) .

  • Differential expression: ADGRE5 levels can discriminate between cancer subtypes. For example, ADGRE5 levels distinguish between small cell lung cancer (SCLC) cell lines (many with low/no expression) and non-small cell lung cancer (NSCLC) cell lines (higher expression) .

  • Functional studies: Research using melanoma models suggests ADGRE5 may have context-dependent roles, functioning as a tumor suppressor in some systems and potentially promoting tumorigenesis in others .

The evidence collectively points to ADGRE5 being involved in cancer biology, although its precise role varies by tumor type and genetic context .

Does ADGRE5 function as a tumor suppressor or oncogene?

The function of ADGRE5 in cancer appears to be context-dependent and potentially dichotomous:

Evidence for tumor suppressor function:

  • In melanoma studies, absence of the X. birchmanni allele of ADGRE5 is associated with malignant transformation, suggesting this allele functions as a tumor suppressor .

  • Expression of ADGRE5 is downregulated in melanomas with high metastatic potential compared to less aggressive forms .

Evidence for oncogenic potential:

  • ADGRE5 is upregulated during cell transformation in multiple tumor types .

  • High expression is observed in melanomas, glioblastomas, and astrocytomas .

  • It is induced in anaplastic thyroid carcinoma, one of the most aggressive tumor types .

Experimental evidence from functional studies:

  • Cell culture experiments comparing different alleles of ADGRE5 show differential effects on cell growth and migration .

  • Binding of tissue transglutaminase (TG2) to ADGRE5 inhibits melanoma growth and metastasis, suggesting its activation can suppress tumor progression in some contexts .

The dual nature of ADGRE5 function may depend on:

  • Tissue-specific context

  • Presence of specific binding partners

  • Post-translational modifications

  • Allelic variations affecting protein function

What are the mechanisms regulating ADGRE5 expression in cancer?

Multiple mechanisms potentially contribute to altered ADGRE5 expression in cancer:

Genetic alterations:

  • Somatic mutations in ADGRE5 are relatively rare in cancer. Analysis of large datasets (TCGA, CGP, ICGC) reveals low mutation frequencies, with hepatocellular carcinoma showing the highest rate at only 2% of cases .

  • Copy number alterations (CNAs) of ADGRE5 are not significantly enriched in tumors and don't explain the altered expression patterns observed .

Epigenetic regulation:

  • Dysregulation of microRNAs (miRNAs) targeting ADGRE5 may contribute to aberrant expression in tumors .

  • Epigenetic changes, including altered methylation patterns, likely play a role in ADGRE5 regulation in cancer contexts .

Transcriptional regulation:

  • The mechanisms leading to transcriptional induction or upregulation of ADGRE5 in tumors remain largely uncharacterized .

  • Further research is needed to identify the transcription factors and signaling pathways responsible for cancer-specific ADGRE5 expression.

The relatively low frequency of genetic alterations suggests that epigenetic and post-transcriptional mechanisms may be the primary drivers of ADGRE5 dysregulation in cancer .

How can I generate stable cell lines expressing ADGRE5 for functional studies?

Based on established methodologies, you can generate stable ADGRE5-expressing cell lines using the following approach:

Vector selection and construction:

  • Use a vector system allowing for inducible expression, such as the doxycycline-inducible pSB-ET-iE vector described in the literature .

  • This vector enables integration of genes via sleeping beauty-mediated transposition and includes:

    • A responsive T6 promoter driving expression of ADGRE5

    • An IRES site followed by a reporter gene (e.g., EGFP)

    • Selection markers (e.g., puromycin resistance)

Cloning procedure:

  • Amplify the ADGRE5 coding sequence using high-fidelity PCR (e.g., Q5 polymerase) from cDNA of appropriate tissue samples.

  • Design primers with appropriate restriction enzyme sites (e.g., XbaI and ClaI).

  • Digest PCR products and vector with respective restriction enzymes.

  • Ligate the digested PCR product into the prepared vector .

Transfection and selection:

  • Transfect target cells using an appropriate method (e.g., Fugene transfection protocol).

  • Select transfected cells with the appropriate antibiotic (e.g., 1 μg/ml puromycin) for approximately 2 weeks.

  • Verify expression using qPCR and western blot to ensure comparable expression levels between different ADGRE5 variants .

Validation:

  • Confirm protein expression and localization by immunofluorescence or flow cytometry.

  • Verify that expression can be induced by doxycycline at various concentrations to allow for experimental dose-response studies.

  • Compare expression levels across different cell lines to ensure experimental consistency .

This approach enables precise control of ADGRE5 expression and facilitates elegant experimental designs for functional characterization .

What cell-based assays are appropriate for studying ADGRE5 function in cancer models?

Several cell-based assays have proven effective for investigating ADGRE5 function in cancer contexts:

Cell growth and proliferation assays:

  • MTT or related colorimetric assays can measure cell growth by comparing optical density readings between induced and non-induced cells

  • Cell count assays using automated cell counters or flow cytometry

  • BrdU incorporation assays to measure DNA synthesis as an indicator of proliferation

Cell adhesion assays:

  • Coating plates with extracellular matrix proteins (e.g., fibronectin at 0.1 μg/mL)

  • Adding recombinant ADGRE5 protein (10 μg/well) to the coating solution

  • Seeding cells and allowing adhesion for 45 minutes at 37°C

  • Quantifying adherent cells through staining and optical density measurement

  • This approach typically shows a 2-4 fold increase in adhesion in the presence of ADGRE5

Cell migration and invasion assays:

  • Transwell migration assays to assess cell motility

  • Scratch/wound healing assays to measure collective cell migration

  • 3D invasion assays using matrigel or collagen matrices to assess invasive capacity

Cell signaling assays:

  • Western blotting to detect activation of downstream pathways

  • Calcium flux assays to measure signaling activity

  • Co-immunoprecipitation to identify protein-protein interactions with ADGRE5, such as interactions with CD81 or Gαq/11

Cell line selection:

  • Non-tumorigenic cell lines such as the murine melanocyte cell line (Melan-a) offer excellent models for studying mechanisms triggering transformation from benign to malignant phenotypes

  • Culture these cells in DMEM with pyruvate, supplemented with 10% FCS and 1% penicillin/streptomycin at 37°C, 5% CO2

These methodologies allow for comprehensive functional characterization of ADGRE5 in cancer contexts, enabling analysis of its effects on key cancer-related phenotypes .

What are the best methods for detecting and measuring ADGRE5 protein expression?

For optimal detection and quantification of ADGRE5 protein, researchers can employ several complementary techniques:

Western blotting:

  • Consider the post-translational processing of ADGRE5 when analyzing results

  • The full-length protein appears at approximately 80 kDa

  • The cleaved N-terminal portion is approximately 60 kDa

  • Use appropriate sample preparation methods that preserve membrane proteins

  • Include positive controls from immune cells with known high ADGRE5 expression

Flow cytometry:

  • Particularly useful for cell surface expression analysis

  • Allows quantification of protein levels on a per-cell basis

  • Can distinguish between different cell populations in mixed samples

  • Essential when working with immune cell infiltrates in tumor samples

Immunohistochemistry (IHC)/Immunofluorescence (IF):

  • Enables visualization of protein localization within tissues or cells

  • Helps distinguish between ADGRE5 on tumor cells versus infiltrating immune cells

  • Consider dual staining with immune cell markers for accurate interpretation

  • Pay attention to membrane versus cytoplasmic staining patterns

ELISA:

  • For quantifying soluble/cleaved forms of ADGRE5 in conditioned media or body fluids

  • Recombinant ADGRE5 can serve as a standard for quantification

RNA analysis as complementary approach:

  • qRT-PCR for targeted analysis of ADGRE5 mRNA levels

  • RNA-seq for genome-wide expression profiling

  • Single-cell RNA-seq to distinguish expression in different cell populations

  • Remember that bulk RNA data primarily represent ADGRE5 in immune cells in mixed samples

When interpreting ADGRE5 expression data, account for the high expression in infiltrating immune cells, which may confound analysis of tumor cell expression. This is particularly important when analyzing tissue samples without single-cell resolution techniques .

How do different ADGRE5 alleles or variants influence cancer progression?

Research on ADGRE5 allelic variation demonstrates significant functional differences that influence cancer progression:

Comparative functional analysis:

  • Studies comparing different alleles of ADGRE5 (e.g., X. birchmanni and X. malinche alleles) show they differentially affect cell growth and migration .

  • The X. birchmanni allele of ADGRE5 appears to function as a tumor suppressor in melanoma models, with its absence associated with malignant transformation .

  • Heterozygous individuals for ADGRE5 showed smaller melanoma spots than homozygous individuals, resulting in a lower probability of developing invasive disease .

Structural variations and functional consequences:

  • Amino acid changes in conserved domains significantly impact function. For example, changes in the epidermal growth factor-like calcium binding site alter ADGRE5 activity .

  • GPS cleavage site mutations affect intracellular trafficking and cell surface expression of ADGRE5 .

  • Alternative splice variants show different functional properties:

    • A splice variant lacking the GPS site shows altered processing

    • Another variant lacking portions of the TM domains shows non-functionality

Experimental approaches to study variant effects:

  • Generate stable cell lines expressing different ADGRE5 variants using inducible expression systems

  • Compare cellular phenotypes (growth, migration, adhesion) between variants

  • Analyze downstream signaling pathway activation

  • Assess in vivo tumor development using xenograft models

These methodological approaches allow for detailed characterization of how specific structural changes in ADGRE5 contribute to cancer progression or suppression in different contexts .

What challenges exist in targeting ADGRE5 for cancer therapy?

Despite ADGRE5's involvement in cancer biology, several significant challenges complicate its potential as a therapeutic target:

Expression pattern complexity:

  • High expression in circulating and tumor-infiltrating immune cells makes systematic targeting difficult .

  • Distinguishing between ADGRE5 on tumor cells versus immune cells presents a major selectivity challenge .

  • Potential for unintended immune effects due to ADGRE5's role in normal immune cell adhesion and migration .

Functional dichotomy:

  • Context-dependent roles as both tumor suppressor and potential oncogene complicate therapeutic strategy .

  • Targeting approach would need to be highly specific to tumor type and genetic context.

  • Potential for opposing effects in different tissues or cancer subtypes .

Technical challenges:

  • As a seven-transmembrane receptor, ADGRE5 presents drug delivery and specificity challenges.

  • The large extracellular domain with complex post-translational modifications complicates antibody development.

  • GPS cleavage creates multiple forms of the protein (cleaved N-terminus may remain associated or be secreted) .

Research gaps:

  • Incomplete understanding of tissue-specific signaling mechanisms.

  • Limited knowledge of how ADGRE5 is transcriptionally regulated in different cancer contexts.

  • Need for more comprehensive patient data correlating ADGRE5 variants with clinical outcomes .

A potential approach to overcome these challenges might involve:

  • Development of highly specific antibodies targeting tumor-specific ADGRE5 epitopes

  • Exploration of downstream effectors that may present more tractable targets

  • Consideration of ADGRE5 as a biomarker rather than direct therapeutic target in some contexts

How does ADGRE5 interact with the tumor microenvironment?

ADGRE5's interaction with the tumor microenvironment represents a complex and important area of research:

Immune cell interactions:

  • ADGRE5 is highly expressed on infiltrating immune cells within tumors, suggesting a role in immune surveillance or evasion .

  • The receptor likely mediates adhesion between immune cells and tumor cells, potentially affecting immune recognition and response .

  • The functional consequences of these interactions remain incompletely characterized but may include:

    • Altered immune cell trafficking

    • Modified immune cell activation states

    • Changed tumor cell immunogenicity

Extracellular matrix (ECM) interactions:

  • ADGRE5 enhances adhesion to ECM components such as fibronectin, with studies showing a 2-4 fold increase in cell adhesion to fibronectin in the presence of ADGRE5 .

  • These interactions may influence:

    • Tumor cell migration and invasion

    • Metastatic potential

    • Resistance to anoikis (detachment-induced cell death)

Stromal cell communication:

  • Low ADGRE5 expression in fibroblasts across multiple tissues suggests potential communication between tumor cells and cancer-associated fibroblasts .

  • The receptor may participate in bidirectional signaling between tumor and stromal cells.

Angiogenesis involvement:

  • CD97/ADGRE5 has been implicated in tumor angiogenesis, as mentioned in the title of search result ("To Detach, Migrate, Adhere, and Metastasize: CD97/ADGRE5 in...").

  • This suggests a role in modulating the tumor vasculature through interactions with endothelial cells.

Experimental approaches to study these interactions:

  • Co-culture systems with tumor cells and various stromal/immune components

  • 3D organoid models incorporating multiple cell types

  • In vivo models with fluorescently labeled cell populations to track interactions

  • Single-cell analysis of tumor microenvironments to map ADGRE5 expression patterns

Understanding these complex interactions is crucial for developing therapeutic strategies that consider both direct effects on tumor cells and indirect effects through the microenvironment .

Why might I observe inconsistent ADGRE5 expression levels in my experimental system?

Several factors can contribute to variability in ADGRE5 expression levels:

Technical considerations:

  • Antibody specificity issues: Many commercial antibodies may not distinguish between full-length and cleaved forms of ADGRE5. Validate antibodies using positive and negative controls .

  • RNA vs. protein discrepancies: Post-transcriptional regulation may cause mRNA and protein levels to differ. Always confirm RNA findings with protein analysis .

  • Extraction method limitations: Standard protein extraction protocols may inefficiently recover transmembrane proteins. Consider specialized membrane protein extraction buffers .

Biological variables:

  • GPS cleavage variability: The cleaved N-terminal portion may remain non-covalently associated or be released into culture medium, affecting detection .

  • Heterogeneous cell populations: Remember that infiltrating immune cells typically have high ADGRE5 expression, which can confound analysis of mixed populations .

  • Cell culture conditions: Confluence level, passage number, and serum conditions can affect ADGRE5 expression and processing.

Experimental design solutions:

  • Use multiple detection methods (western blot, flow cytometry, qPCR) for comprehensive assessment

  • Include appropriate positive controls (immune cells with known high expression)

  • For inducible systems, establish and validate dose-response relationships with the inducing agent

  • Validate expression at both mRNA and protein levels

  • When possible, use single-cell techniques to resolve population heterogeneity

Controlling for these variables will improve reproducibility and reliability of ADGRE5 expression analysis.

What controls should I include when studying ADGRE5 function in cancer models?

Robust experimental design for ADGRE5 studies requires several types of controls:

Expression controls:

  • Positive tissue controls: Include immune cells (particularly myeloid lineage cells) known to express high levels of ADGRE5 .

  • Negative controls: Use cell types or tissues with minimal ADGRE5 expression, such as certain SCLC cell lines that show negligible expression .

  • Expression level verification: Confirm comparable expression levels between different ADGRE5 variants to ensure phenotypic differences aren't due to expression variability .

Functional controls:

  • Empty vector controls: Essential when using expression systems to distinguish effects of ADGRE5 from those of transfection or selection.

  • Uninduced controls: For inducible systems, maintain parallel uninduced cultures (dox 0) as reference points .

  • Mutant controls: Include non-functional ADGRE5 variants (e.g., GPS cleavage site mutants) to confirm specificity of observed phenotypes .

Experimental methodology controls:

  • Ligand binding controls: When studying ADGRE5-ligand interactions, include known binding partners like tissue transglutaminase (TG2) as positive controls .

  • Adhesion assay controls: For fibronectin adhesion experiments, include wells with and without recombinant ADGRE5 (10 μg/well) .

  • Cell type controls: Compare effects in tumorigenic versus non-tumorigenic cell backgrounds (e.g., melanoma cells versus Melan-a cells) .

Data analysis controls:

  • Statistical controls: Implement appropriate statistical tests with multiple biological replicates (minimum n=3).

  • Blinding procedures: When possible, blind the analysis of phenotypic outcomes to prevent bias.

  • Technical replicates: Include multiple technical replicates within each biological replicate.

Implementing these comprehensive controls will strengthen data interpretation and improve reproducibility across different experimental systems .

How can I differentiate between ADGRE5 expression in tumor cells versus infiltrating immune cells?

Distinguishing ADGRE5 expression between tumor cells and infiltrating immune cells is critical for accurate interpretation of results:

Single-cell resolution techniques:

  • Single-cell RNA sequencing: Provides comprehensive expression profiles that can distinguish cell types based on transcriptomic signatures .

  • Flow cytometry: Use multi-parameter panels with both ADGRE5 and lineage-specific markers (e.g., CD45 for immune cells, tumor-specific markers for cancer cells).

  • Mass cytometry (CyTOF): Enables simultaneous detection of numerous markers to precisely identify cell populations expressing ADGRE5.

Imaging-based approaches:

  • Multiplexed immunofluorescence: Co-stain for ADGRE5 alongside immune markers (CD45, CD3, CD68) and tumor markers.

  • In situ hybridization (RNAscope): Visualize ADGRE5 mRNA expression with cellular resolution in tissue sections.

  • Laser capture microdissection: Physically separate tumor regions from infiltrating immune cells for subsequent analysis.

Cell isolation strategies:

  • Fluorescence-activated cell sorting (FACS): Sort distinct cell populations before ADGRE5 analysis.

  • Magnetic-activated cell sorting (MACS): Deplete immune cells using CD45 microbeads prior to tumor cell analysis.

  • Differential culture conditions: Establish primary cultures under conditions favoring tumor cell growth over immune cell survival.

Analytical approaches:

  • Deconvolution algorithms: Apply computational methods to bulk RNA-seq data to estimate contributions from different cell types.

  • Reference-based analysis: Compare expression patterns to reference datasets of purified cell populations.

  • Spatial transcriptomics: Newer technologies that preserve spatial information while providing transcriptomic data.

Experimental considerations:

  • Remember that bulk ADGRE5 RNA data from both normal and tumor tissues primarily represent ADGRE5 in immune cells .

  • When analyzing published datasets, consider whether the methodology distinguished between cell types.

  • In xenograft models, use species-specific primers/antibodies to distinguish human tumor cells from mouse stromal/immune cells .

Implementing these approaches will provide more accurate characterization of cell type-specific ADGRE5 expression and function in the complex tumor microenvironment .

What are promising avenues for therapeutic targeting of ADGRE5 in cancer?

Despite challenges, several innovative approaches show promise for therapeutic targeting of ADGRE5:

Targeted antibody approaches:

  • Development of antibodies specifically targeting tumor-associated epitopes or post-translational modifications of ADGRE5

  • Antibody-drug conjugates (ADCs) that selectively deliver cytotoxic agents to ADGRE5-expressing tumor cells

  • Bispecific antibodies linking ADGRE5-expressing cells to immune effectors

Signaling pathway modulation:

  • Targeting downstream effectors of ADGRE5 that may be more specifically altered in tumor cells

  • Identification of cancer-specific ADGRE5 signaling partners for selective intervention

  • Development of small molecules that modulate ADGRE5's interaction with specific binding partners (e.g., enhancing TG2 binding to promote tumor suppression)

Context-specific approaches:

  • Stratification of patients based on ADGRE5 expression patterns and cancer subtypes

  • Cancer-specific interventions that consider the dual nature of ADGRE5 function

  • Combine ADGRE5 targeting with immune checkpoint inhibitors to address both tumor and immune aspects

Technological innovations:

  • Nanoparticle delivery systems with enhanced tumor specificity

  • PROTAC (Proteolysis Targeting Chimera) approaches for selective ADGRE5 degradation

  • mRNA or gene therapy approaches to restore tumor suppressor functions of specific ADGRE5 variants

Biomarker applications:

  • Development of ADGRE5 as a prognostic or predictive biomarker

  • Use of ADGRE5 expression patterns to guide treatment selection

  • Monitoring changes in soluble ADGRE5 fragments as indicators of treatment response

These approaches recognize the complex biology of ADGRE5 and aim to develop more precise interventions that account for its context-dependent roles in cancer progression .

What methodological advances would improve our understanding of ADGRE5 biology?

Several emerging technologies and methodological approaches could significantly advance ADGRE5 research:

Advanced structural biology techniques:

  • Cryo-electron microscopy to determine the full structure of ADGRE5 in different conformational states

  • Hydrogen-deuterium exchange mass spectrometry to map dynamic protein interactions

  • Single-molecule FRET to observe real-time conformational changes during activation

Genome engineering approaches:

  • CRISPR-Cas9 base editing to introduce specific ADGRE5 variants while maintaining endogenous expression levels

  • CRISPR activation/inhibition systems for precise temporal control of expression

  • Knock-in reporter systems for real-time visualization of ADGRE5 expression and trafficking

Advanced imaging technologies:

  • Super-resolution microscopy to visualize ADGRE5 clustering and membrane organization

  • Intravital imaging to track ADGRE5-expressing cells in tumor microenvironments

  • Proximity labeling techniques (BioID, APEX) to map the ADGRE5 interactome in living cells

Systems biology approaches:

  • Multi-omics integration combining transcriptomics, proteomics, and metabolomics data

  • Network analysis to position ADGRE5 within cancer-relevant signaling pathways

  • Machine learning algorithms to identify patterns in large datasets linking ADGRE5 variants to clinical outcomes

Translational research tools:

  • Patient-derived organoids to study ADGRE5 function in clinically relevant models

  • Humanized mouse models expressing patient-specific ADGRE5 variants

  • Liquid biopsy techniques to detect circulating ADGRE5 fragments as biomarkers

Data sharing and standardization:

  • Development of standardized protocols for ADGRE5 detection and functional analysis

  • Creation of public repositories for ADGRE5 variant data linked to phenotypic information

  • Collaborative research networks focused on aGPCR biology in cancer

These methodological advances would address current limitations in understanding ADGRE5's complex biology and accelerate translation of basic findings into clinical applications .

How might evolutionary analysis of ADGRE5 inform cancer research?

Evolutionary perspectives on ADGRE5 offer valuable insights for cancer research:

Comparative genomics insights:

  • Analysis of ADGRE5 across species reveals conserved domains likely critical for function

  • Human ADGRE5 shares 71-80% amino acid identity with mouse, rat, canine, equine, and bovine orthologs within the cleaved ECD region

  • Evolutionary conservation can highlight functionally significant regions for targeted intervention

Allelic variation studies:

  • Natural allelic variants in different species (e.g., X. birchmanni vs. X. malinche) show significant functional differences in melanoma models

  • Five amino acid changes between species, including one in a conserved EGF-like calcium binding site, contribute to differential tumor suppressor activity

  • These natural experiments reveal structure-function relationships that may inform therapeutic design

Evolutionary trade-offs:

  • ADGRE5's dual roles in immune function and cancer progression suggest evolutionary trade-offs

  • Selection pressures for immune function may have maintained variants with potential oncogenic effects

  • Understanding these trade-offs could inform approaches that target cancer-specific functions while preserving immune functions

Experimental approaches leveraging evolutionary insights:

  • Create chimeric ADGRE5 proteins combining domains from different species to isolate functional regions

  • Perform site-directed mutagenesis targeting evolutionarily divergent residues

  • Develop in vivo models expressing ADGRE5 variants from different species

  • Map cancer-associated mutations onto evolutionary conservation profiles to predict functional impact

This evolutionary perspective provides a unique lens for understanding ADGRE5 biology and may reveal novel approaches for therapeutic intervention that would not be apparent from studying human variants alone .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.