Recombinant Human CDP-diacylglycerol--inositol 3-phosphatidyltransferase (CDIPT)

Shipped with Ice Packs
In Stock

Description

Key Functional Properties:

  • Catalytic Activity:

    • Synthesizes phosphatidylinositol via the transfer of inositol to CDP-diacylglycerol .

    • Facilitates PtdIns:inositol exchange, regulated by CMP .

  • Structural Features:

    • Molecular weight: ~18–23.5 kDa (varies by isoform and expression system) .

    • Contains conserved domains for substrate binding and enzymatic activity .

Recombinant Production and Purification

Recombinant CDIPT is produced using diverse expression systems, each optimized for specific research needs:

Expression SystemHostPurityTagApplications
E. coliBacterial≥85%N-/C-terminal tags Structural studies
HEK-293 CellsMammalian>90%NoneFunctional assays
Wheat GermCell-freeN/AStrep Tag ELISA, Western blot
Yeast/BaculovirusInsect/Mammalian>90%Custom tags High-throughput screens

Storage: Lyophilized or liquid formats; stable at -80°C with minimal freeze-thaw cycles .

3.1. Mechanistic Studies

  • Lipid Metabolism: Essential for studying glycerophospholipid and inositol phosphate pathways .

  • Signaling Pathways: Investigates roles in GPCR and tyrosine kinase signaling cascades .

3.2. Disease Associations

Disease CategoryRelevanceCitations
Nervous System DisordersLinked to phosphatidylinositol signaling defects
Liver DiseasesImplicated in fatty liver pathology
CancerAltered expression in mammary neoplasms

3.3. Technical Uses

  • ELISA/Western Blot: Detects CDIPT in tissue homogenates and cell lysates .

  • Enzyme Activity Assays: Measures PtdIns synthase activity in vitro .

Key Research Findings

  • Isoform Diversity: Multiple transcript variants encode distinct isoforms with tissue-specific roles .

  • Jojoba Lipid Synthesis: CDIPT homologs in Simmondsia chinensis regulate phospholipid biosynthesis during seed development .

  • Therapeutic Targets: Potential link to drug toxicity and metabolic disorders .

Quality Control and Validation

  • Purity: Validated via SDS-PAGE (>85–90%) .

  • Activity: Confirmed through enzymatic assays measuring PtdIns synthesis .

  • Sterility: Optional endotoxin-free and sterile-filtered formats .

Future Directions

Emerging studies focus on CDIPT’s role in cancer progression and neurodegenerative diseases, leveraging recombinant protein tools for high-resolution structural analysis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement during order placement. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
CDIPT; PIS; PIS1; CDP-diacylglycerol--inositol 3-phosphatidyltransferase; Phosphatidylinositol synthase; PI synthase; PtdIns synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-213
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MPDENIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQG TRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESH KMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTA PIALLKSLISVIHLITAARNMAALDAADRAKKK
Uniprot No.

Target Background

Function
Catalyzes the biosynthesis of phosphatidylinositol (PtdIns) as well as the PtdIns:inositol exchange reaction. This may act to reduce excessive cellular PtdIns content. The exchange activity is attributed to the reverse reaction of PtdIns synthase and is dependent on CMP, which binds tightly to the enzyme.
Gene References Into Functions
  1. Elevated CDIPT expression has been identified as an early event in oral cancer and a potential target for smokeless tobacco. PMID: 20426864
  2. Alpha-1-antitrypsin deficiency affects at least 120.5 million carriers and deficient individuals globally, primarily due to the two most prevalent deficiency alleles PIZ. PMID: 16312203
Database Links

HGNC: 1769

OMIM: 605893

KEGG: hsa:10423

STRING: 9606.ENSP00000219789

UniGene: Hs.121549

Protein Families
CDP-alcohol phosphatidyltransferase class-I family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in placenta (at protein level). Widely expressed. Higher expression in adult liver and skeletal muscle, slightly lower levels seen in pancreas, kidney, lung, placenta, brain, heart, leukocyte, colon, small intestine, ovary, testis, prostate, thym

Q&A

What is CDIPT and what is its primary enzymatic function?

CDIPT (CDP-diacylglycerol--inositol 3-phosphatidyltransferase) is an enzyme that catalyzes the biosynthesis of phosphatidylinositol (PtdIns) . It belongs to the family of transferases, specifically the CDP-alcohol phosphatidyltransferase class-I family . The enzyme catalyzes the following chemical reaction:

CDP-diacylglycerol + myo-inositol → CMP + phosphatidyl-1D-myo-inositol

CDIPT is also known by several other names, including phosphatidylinositol synthase (PI synthase), PtdIns synthase, and PIS . In humans, the canonical protein has a reported length of 213 amino acid residues and a mass of 23.5 kDa . This enzyme plays a crucial role in glycerophospholipid metabolism and phosphatidylinositol signaling systems, which are essential for numerous cellular processes .

What is the subcellular localization of CDIPT and how does this relate to its function?

CDIPT is an integral membrane protein primarily localized to the endoplasmic reticulum (ER) and the Golgi apparatus, specifically on the cytoplasmic side of these organelles . This strategic localization allows CDIPT to access its substrates, CDP-diacylglycerol and myo-inositol, and synthesize phosphatidylinositol at the interface of cellular membranes .

The membrane localization is critical for its function as phosphatidylinositol synthesis is a key step in membrane biogenesis. Additionally, the products of CDIPT activity serve as precursors for phosphoinositides, which are important second messengers in cellular signaling pathways that regulate cell growth, calcium metabolism, and protein kinase C activity .

What techniques are most effective for detecting CDIPT in experimental systems?

Several techniques have proven effective for detecting CDIPT in research settings, with the most common methods being:

Detection MethodApplicationsAvailable Antibody TypesCommon Reactivity
Western Blot (WB)Protein expression analysisMonoclonal, Polyclonal, RecombinantHuman, Mouse, Rat
ELISAQuantitative analysisMonoclonal, PolyclonalHuman, Mouse, Rat
Flow Cytometry (FCM)Cellular analysisMonoclonalHuman, Mouse
Immunohistochemistry (IHC-p)Tissue localizationMonoclonal, PolyclonalHuman, Mouse
Immunofluorescence (IF)Subcellular localizationRecombinantHuman, Mouse

Data compiled from search results

When selecting detection methods, researchers should consider that Western Blot is the most commonly used application for CDIPT antibodies . For optimal results, recommended starting dilutions vary by application: ELISA (1:1,000), Western Blot (1:100-500), IHC (1:50-100), and FACS (1:10-50) .

How can recombinant CDIPT be utilized in phospholipid metabolism research?

Recombinant CDIPT provides researchers with a valuable tool for investigating phospholipid metabolism pathways. Key applications include:

  • Enzymatic Assays: Recombinant CDIPT can be used to study the kinetics of phosphatidylinositol synthesis in controlled in vitro conditions.

  • Structural Studies: Purified recombinant CDIPT enables crystallography and other structural biology approaches to understand the enzyme's catalytic mechanism.

  • Protein-Protein Interaction Studies: Recombinant CDIPT with appropriate tags (such as GST) facilitates pull-down assays to identify interaction partners in the phospholipid synthesis pathway .

  • Antibody Validation: Recombinant CDIPT serves as a positive control for validating the specificity of anti-CDIPT antibodies used in various detection methods .

  • Functional Reconstitution: Incorporating recombinant CDIPT into liposomes or membrane mimetics allows functional studies of phosphatidylinositol synthesis in a reconstituted system.

The recombinant human CDIPT with GST (N-Term) tag produced in wheat germ expression systems may preserve the correct conformational folding necessary for biological activity, making it suitable for functional studies .

What model organisms are most suitable for studying CDIPT function?

Several model organisms have proven valuable for CDIPT research, with zebrafish emerging as particularly informative:

Model OrganismAdvantagesKey Findings
ZebrafishTransparent embryos, genetic tractabilityCDIPT required for lens structural integrity and photoreceptor survival
MouseMammalian physiology, genetic similarity to humansCDIPT gene orthologs reported, antibodies available for detection
RatLarger size, physiological studiesAntibodies available for rat CDIPT detection
YeastSimple eukaryote, robust genetic toolsHeterologous yeast phenotypic complementation assay confirmed zebrafish CDIPT function

Zebrafish models have been particularly informative, with the lens opaque (lop) mutant demonstrating that CDIPT is required for survival of photoreceptor cells and lens epithelial and secondary cortical fiber cells . The zebrafish cdipt alleles represent excellent in vivo genetic tools to study the role of phosphatidylinositol and its phosphorylated derivatives in lens and photoreceptor development and maintenance .

How do mutations in CDIPT affect cellular and developmental processes?

Mutations in CDIPT have significant impacts on cellular homeostasis and development, particularly in specialized tissues. Research findings demonstrate:

  • Photoreceptor Degeneration: In zebrafish, the cdipt(lop/lop) mutant exhibits a loss of rod and cone photoreceptors by 7 days post-fertilization (dpf) .

  • Lens Opacity: CDIPT mutations lead to cataract formation in zebrafish models, suggesting a critical role in lens development and maintenance .

  • Temporal Progression: The cdipt(hi559/hi559) mutants first exhibited photoreceptor layer disruption and photoreceptor cell death at 3 and 4 dpf, followed by lens dismorphogenesis by 5 dpf, indicating a sequential pathological process .

  • Endoplasmic Reticulum Stress: Lack of de novo phosphatidylinositol synthesis due to CDIPT deficiency leads to ER stress, contributing to cellular dysfunction .

  • Hepatic Steatosis: CDIPT-deficient zebrafish develop fatty liver disease, indicating the importance of phosphatidylinositol metabolism in lipid homeostasis .

In humans, CDIPT gene mutations have been identified in a 4-year-old male with seizures, involuntary muscle contractions, and global developmental issues, suggesting a potential role in neurological development .

What is the relationship between CDIPT dysfunction and disease pathology?

CDIPT dysfunction appears to contribute to multiple pathological states through several mechanisms:

  • Neurological Disorders: Genetic changes in CDIPT have been associated with seizures and involuntary muscle contractions, suggesting a role in neuronal function and development .

  • Visual System Pathologies: Research in zebrafish demonstrates that CDIPT is essential for photoreceptor survival and lens development, with mutations leading to blindness and cataracts .

  • Hepatic Dysfunction: CDIPT deficiency leads to endoplasmic reticulum stress and hepatic steatosis, indicating its importance in liver function and lipid metabolism .

  • Intestinal Inflammation: Dysregulated phosphatidylinositol signaling promotes endoplasmic-reticulum-stress-mediated intestinal mucosal injury and inflammation, suggesting a role for CDIPT in intestinal barrier function .

  • Developmental Abnormalities: The requirement for CDIPT during critical developmental windows suggests that its dysfunction may contribute to broader developmental disorders .

The mechanistic link between these conditions appears to involve disruption of phosphatidylinositol synthesis, which affects membrane integrity, cellular signaling pathways, and organelle function, particularly in the endoplasmic reticulum.

How does CDIPT activity influence phosphatidylinositol signaling systems?

CDIPT plays a foundational role in phosphatidylinositol signaling systems through its catalytic activity:

  • Precursor Synthesis: CDIPT catalyzes the synthesis of phosphatidylinositol, which serves as the precursor for all phosphoinositides involved in signal transduction .

  • Membrane Composition: By contributing to the phospholipid composition of cellular membranes, CDIPT activity influences the localization and function of membrane-associated signaling proteins .

  • Second Messenger Generation: Phosphatidylinositol breakdown products function as ubiquitous second messengers downstream of many G protein-coupled receptors and tyrosine kinases .

  • Regulatory Functions: These phosphatidylinositol-derived signaling molecules regulate cell growth, calcium metabolism, and protein kinase C activity .

  • Pathway Integration: Through its role in generating signaling lipids, CDIPT activity integrates with multiple cellular pathways including those involved in growth, differentiation, and stress responses .

Disruption of CDIPT function therefore has cascading effects on multiple signaling pathways that depend on phosphoinositides as second messengers or membrane anchors.

What are the critical considerations when designing experiments involving recombinant CDIPT?

When designing experiments with recombinant CDIPT, researchers should consider these critical factors:

  • Expression System Selection: The wheat germ in vitro expression system has been successfully used to produce recombinant human CDIPT with GST tag, as it helps preserve correct conformational folding necessary for biological function .

  • Protein Tagging Strategy: The addition of tags (such as GST at the N-terminus) can facilitate purification but may affect enzyme activity. Consider the position of tags relative to the catalytic domain (amino acids 1-213 in human CDIPT) .

  • Predicted Properties: Human CDIPT with GST tag has a predicted molecular mass of 49.17 kDa, though observed molecular weight may vary due to post-translational modifications, cleavages, relative charges, and other experimental factors .

  • Storage Conditions: For optimal stability, store recombinant CDIPT at -80°C and avoid freeze-thaw cycles to maintain protein integrity .

  • Buffer Composition: Consider using optimal buffer conditions such as 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 for elution and storage .

  • Membrane Association: As an integral membrane protein, CDIPT may require detergents or lipid environments for optimal activity and stability in in vitro experiments .

  • Activity Verification: While recombinant CDIPT should theoretically display enzymatic activity, functional validation through appropriate assays is recommended before proceeding with complex experiments .

What controls should be included when studying CDIPT in knockout or knockdown models?

Proper experimental controls are essential when studying CDIPT function through gene manipulation approaches:

  • Genetic Controls:

    • Wild-type controls from the same genetic background

    • Heterozygous individuals for comparison with homozygous mutants

    • Rescue experiments using wild-type cdipt mRNA injection to confirm phenotype specificity

  • Phenotypic Analysis Controls:

    • Temporal characterization of phenotypes (e.g., examining homozygous cdipt mutants prior to gross lens opacification to determine initial cellular defects)

    • Comparison of different mutant alleles (e.g., cdipt(lop/lop) and cdipt(hi559/hi559)) to confirm gene-specific effects

  • Expression Controls:

    • RT-PCR to confirm maternal expression and tissue-specific transcription patterns

    • Immunohistochemistry with anti-zebrafish PI synthase polyclonal antiserum to confirm protein reduction in mutants

  • Functional Controls:

    • Heterologous yeast phenotypic complementation assay to confirm that wild-type alleles encode functional PI synthase activity

    • Morpholino-mediated knockdown to phenocopy the mutant and confirm gene-specific effects

  • Pathway Controls:

    • Analysis of downstream effects on phosphatidylinositol levels and dependent signaling pathways

    • Examination of associated endoplasmic reticulum stress markers to confirm secondary effects

How can researchers differentiate between direct and indirect effects of CDIPT manipulation?

Distinguishing direct from indirect effects of CDIPT manipulation requires multiple complementary approaches:

  • Temporal Analysis: Establishing a timeline of phenotypic manifestations can help determine primary versus secondary effects. For example, in zebrafish cdipt mutants, photoreceptor layer disruption precedes lens dismorphogenesis, suggesting potentially different mechanisms .

  • Tissue-Specific Expression Analysis: RT-PCR and immunolocalization can identify where CDIPT is expressed and potentially functioning. This helps correlate expression patterns with observed phenotypes .

  • Rescue Experiments: Microinjection of wild-type cdipt mRNA into mutant embryos can reverse specific phenotypes, indicating direct gene effects. For example, injection of wild-type cdipt mRNA into cdipt(lop/lop) embryos significantly reduced the percentage of larvae displaying lens opacity .

  • Pathway Analysis: Examining the status of phosphatidylinositol levels and downstream signaling pathways can help establish mechanistic links between CDIPT deficiency and observed phenotypes.

  • Cellular Stress Markers: Assessing markers of cellular stress (particularly ER stress) can help determine if phenotypes result directly from CDIPT deficiency or from secondary stress responses .

  • Cross-Species Validation: Confirming findings across multiple model systems strengthens causal relationships. For instance, complementation in heterologous systems (like yeast) can validate the functional significance of CDIPT mutations .

What methods are available for functional analysis of CDIPT genetic variants?

Several approaches can be employed to assess the functional impact of CDIPT genetic variants:

  • Animal Model Generation:

    • Zebrafish models have proven particularly valuable for studying CDIPT mutations, with the lop mutant (Ser-111-Cys substitution in the PI synthase catalytic domain) demonstrating clear phenotypes

    • CRISPR-Cas9 engineering can be used to introduce specific mutations for functional analysis

  • Cellular Models:

    • Human induced pluripotent stem cells (iPSCs) can be genetically modified to carry CDIPT variants and differentiated into relevant cell types

    • Functional readouts in cellular models can include membrane composition analysis, phosphatidylinositol levels, and cellular stress markers

  • Biochemical Assays:

    • In vitro enzymatic activity assays using purified recombinant wild-type and variant CDIPT proteins

    • Analysis of substrate binding and product formation rates

  • Heterologous Expression Systems:

    • Complementation assays in yeast or bacterial systems lacking endogenous CDIPT activity

    • Rescue of growth or biochemical phenotypes as a measure of variant functionality

  • SNP Analysis in Target Species:

    • In agricultural research, SNPs at the 3'-UTR of CDIPT have been associated with meat quality traits in cattle, providing a model for studying regulatory variants

    • PCR-RFLP and DNA sequencing methods can be used to detect these variants

Understanding the functional consequences of CDIPT variants is particularly important given its association with human neurological disorders and potential agricultural applications .

What are emerging therapeutic approaches targeting CDIPT-related pathways?

While direct CDIPT-targeted therapeutics are still in early development stages, several approaches show promise based on understanding of CDIPT function and related pathways:

  • RHOA Inhibition: Research on 16p11.2 deletion (a CNV associated with neurodevelopmental disorders) demonstrated that iPSC-derived dopaminergic neurons with this deletion exhibit hyperactivation that can be rescued by RHOA inhibition. Though not directly targeting CDIPT, this approach addresses downstream signaling pathways that may intersect with phosphatidylinositol metabolism .

  • ER Stress Modulators: Given that CDIPT deficiency leads to endoplasmic reticulum stress, compounds that modulate ER stress responses could potentially mitigate pathological consequences in tissues affected by CDIPT dysfunction .

  • Phosphoinositide Pathway Modulation: Interventions that restore or bypass disrupted phosphoinositide signaling could potentially compensate for CDIPT dysfunction in certain contexts.

  • Gene Therapy Approaches: The successful rescue of phenotypes through mRNA injection in zebrafish models suggests potential for gene therapy approaches in conditions associated with CDIPT mutations .

  • Targeted Nutritional Interventions: Given CDIPT's role in phospholipid metabolism, specialized lipid formulations might partially compensate for metabolic disruptions in certain tissues.

These approaches remain largely experimental, with most evidence coming from model systems rather than clinical applications.

How does CDIPT function integrate with other phospholipid metabolism pathways?

CDIPT occupies a critical node in phospholipid metabolism networks, with multiple connections to other pathways:

  • Glycerophospholipid Metabolism: CDIPT catalyzes a key step in glycerophospholipid metabolism, converting CDP-diacylglycerol to phosphatidylinositol, a major membrane phospholipid .

  • Phosphatidylinositol Signaling System: The phosphatidylinositol produced by CDIPT serves as the precursor for all phosphoinositides involved in cellular signaling, including phosphatidylinositol phosphates that regulate numerous cellular processes .

  • Membrane Biogenesis Pathways: Through its role in phosphatidylinositol synthesis, CDIPT contributes to membrane composition and properties, affecting membrane protein function and trafficking.

  • Lipid Droplet Formation: CDIPT deficiency in zebrafish leads to hepatic steatosis, suggesting a connection between phosphatidylinositol metabolism and lipid droplet dynamics .

  • Stress Response Pathways: CDIPT function appears linked to endoplasmic reticulum stress responses, with deficiency leading to activation of ER stress pathways .

  • Developmental Programs: The specific developmental defects observed in CDIPT-deficient organisms indicate integration with tissue-specific developmental pathways, particularly in the eye and nervous system .

Understanding these integrated networks is essential for comprehending the systemic effects of CDIPT dysfunction and identifying potential points of intervention.

What technological advances are improving our ability to study CDIPT function?

Recent technological developments have enhanced our capacity to investigate CDIPT biology:

  • CRISPR-Cas9 Genome Editing: This technology enables precise engineering of CDIPT mutations in various model systems, including human iPSCs, facilitating the study of specific variants .

  • iPSC-Derived Specialized Cell Types: The ability to generate dopaminergic neurons and other specialized cell types from iPSCs carrying specific genetic modifications allows for detailed cellular phenotyping in human-relevant models .

  • Advanced Imaging Techniques: Improved microscopy methods enable better visualization of subcellular CDIPT localization and the effects of its dysfunction on cellular structures.

  • Lipidomics: Mass spectrometry-based lipidomics approaches allow comprehensive profiling of phospholipids, providing detailed insights into how CDIPT affects the lipidome.

  • Single-Cell Analysis: Technologies for analyzing gene expression and protein levels at the single-cell level enable more nuanced understanding of CDIPT function in heterogeneous tissues.

  • Network Analysis Tools: Computational approaches for analyzing complex biological networks help place CDIPT function in broader cellular contexts.

  • People Also Ask Data Mining: The collection and analysis of "People Also Ask" data from search engines provides valuable insights into common research questions about CDIPT, guiding future research directions .

These technological advances collectively enhance our ability to understand CDIPT biology from molecular to systemic levels, potentially accelerating the development of interventions for CDIPT-related disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.