Recombinant Human Cell cycle control protein 50A (TMEM30A)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Cell Cycle Control Protein 50A (TMEM30A)

Recombinant Human Cell cycle control protein 50A, also known as TMEM30A or CDC50A, is a protein that in humans is encoded by the TMEM30A gene . TMEM30A serves as a crucial subunit of P4-ATPases, which are phospholipid flippases responsible for maintaining the asymmetric distribution of phospholipids across the plasma membrane in mammalian cells . Specifically, P4-ATPases maintain phosphatidylserine (PS) and phosphatidylethanolamine (PE) abundance . TMEM30A is the essential β subunit of most P4-ATPases, facilitating their transport and functions .

Basic Information of TMEM30A

FeatureDescription
NameTransmembrane protein 30A
AliasesCell cycle control protein 50A, CDC50A
GeneTMEM30A
FunctionSubunit of P4-ATPases; facilitates phospholipid transport, aminophospholipid flippase activity, structural molecule activity
InvolvementErythropoiesis, homeostasis, regulation of NK cell cytotoxicity, tumor formation, drug and choline phospholipids uptake
ExpressionWidely expressed β-subunit
InteractionsInteracts with multiple P4-ATPases

Role in Intracellular Trafficking and Flippase Activity

TMEM30A is vital for the flippase activity of P4-ATPases, which involves the translocation of phospholipids from one leaflet of a cell membrane to another . It interacts with multiple P4-ATPases and is essential for their proper localization and function . For example, the excision of TMEM30A in cell lines can cause defects in membrane ruffle formation by impairing the endoplasmic reticulum (ER) exit of P4-ATPases, which subsequently inhibits cell migration . TMEM30A also promotes the uptake of anticancer drugs and choline phospholipids into mammalian cells .

Involvement in Disease

  • Neurodegeneration: Studies have demonstrated that loss of Tmem30a in Purkinje cells (PCs) leads to protein folding and transport defects, decreased dendritic spine density, and increased astrogliosis and PC death . Tmem30a is essential for the ER homeostasis and the survival of cerebellar PCs, providing a direct link between Tmem30a functions and neurodegeneration .

  • Retinal Degeneration: Research indicates that loss of Tmem30a in mouse cone cells results in mislocalization of cone opsin, loss of photopic electroretinogram (ERG) responses, and loss of cone cells . Broad deficiency of Tmem30a in adult mice causes a reduced scotopic photoresponse and mislocalization of PS flippase ATP8A2, leading to retinal rod and cone cell dysfunction and death .

  • Hematological Malignancies: Deletion of the TMEM30A gene can provide protection to cancer cells from natural killer (NK) cell killing . TMEM30A-knock-out cells from various hematological malignancies were more resistant to NK cell killing because disruption of the gene caused phosphatidylserine accumulation on the outside of the cells .

  • Embryonic Lethality and Anemia: Studies have found that Tmem30a deficient mice die in utero by E16.5 with severe anemia . Tmem30a deficiency impairs flippase activity, lipid rafts formation, and activation of EPOR/JAK2/STAT5/BCL-XL pathway .

  • Alzheimer's Disease: Data suggests that TMEM30A is involved in betaCTF-dependent endosome abnormalities that are related to Abeta overproduction .

TMEM30A in Mouse Models

Mouse models with disrupted Tmem30a expression have provided valuable insights into its functions:

ModelPhenotype
Purkinje Cell-Specific KnockoutEarly-onset ataxia, progressive Purkinje cell death, increased expression of Glial fibrillary acidic protein and astrogliosis
Retinal-Specific KnockoutMislocalization of cone opsin, loss of photopic electroretinogram (ERG) responses, loss of cone cells, reduced scotopic photoresponse
Hematopoietic-Specific KnockoutEmbryonic lethality due to severe anemia
TMEM30A Knock-out CellsMore resistant to NK cell killing due to phosphatidylserine accumulation on the outside of the cells

These models highlight the importance of TMEM30A in various tissues and systems, demonstrating its essential roles in maintaining cellular homeostasis and preventing disease.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
TMEM30A; C6orf67; CDC50A; Cell cycle control protein 50A; P4-ATPase flippase complex beta subunit TMEM30A; Transmembrane protein 30A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-361
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
AMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIF IPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCFCTINFTLEKSFEGNVFMY YGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFND TLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVY MLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYPV HYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKYRNSSNTADITI
Uniprot No.

Target Background

Function
Recombinant Human Cell cycle control protein 50A (TMEM30A) is an accessory component of a P4-ATPase flippase complex. This complex catalyzes ATP hydrolysis, coupled with the translocation of aminophospholipids from the outer to the inner leaflet of various membranes. This maintains the asymmetric phospholipid distribution crucial for several cellular processes. Phospholipid translocation is implicated in vesicle formation and the uptake of lipid signaling molecules. The beta subunit likely assists in substrate binding. TMEM30A is essential for the proper folding, assembly, and ER-to-Golgi transport of the ATP8A2:TMEM30A flippase complex. The ATP8A2:TMEM30A complex is involved in neurite outgrowth regulation and, when reconstituted into liposomes, primarily transports phosphatidylserine (PS) and, to a lesser extent, phosphatidylethanolamine (PE). The ATP8A1:TMEM30A flippase complex appears to regulate cell migration, potentially via flippase-mediated phosphatidylethanolamine (PE) translocation at the plasma membrane. TMEM30A is also required for the formation of intermediate phosphoenzymes in ATP8A2, ATP8B1, and ATP8B2 P-type ATPases. It participates in the uptake of platelet-activating factor (PAF), the synthetic drug alkylphospholipid edelfosine, and, likely in association with ATP8B1, perifosine. Furthermore, TMEM30A mediates the export of alpha subunits (ATP8A1, ATP8B1, ATP8B2, ATP8B4, ATP10A, ATP10B, ATP10D, ATP11A, ATP11B, and ATP11C) from the ER to other membrane locations.
Gene References Into Functions
  1. Studies show that the extracellular domain of CDC50A is crucial for its chaperone function in delivering ATP11C to the plasma membrane and activating ATP11C's ATP hydrolysis-coupled flippase activity. PMID: 29276178
  2. The lipid flippase (ATP8B1)-TMEM30A heterodimer is essential for the apical localization of the sodium-dependent bile acid transporter (SLC10A2/ASBT) in Caco-2 cells. PMID: 25239307
  3. ATP11C and TMEM30A are necessary for aminophospholipid translocation across the plasma membrane, demonstrating flippase activity. PMID: 24904167
  4. The ATP8A1 and TMEM30A phospholipid flippase complex plays a role in cell migration. PMID: 23269685
  5. Human TMEM30A partially reconstitutes choline phospholipid import in *Saccharomyces cerevisiae* ΔLEM3 vectors, indicating functional orthology with Lem3p. PMID: 21289302
  6. TMEM30A is critical for perifosine uptake in human cells, likely by forming a functional plasma membrane transporter. PMID: 20510206
  7. TMEM30A may function as a beta-subunit or chaperone for ATP8B1 in hepatocytes. PMID: 17948906
Database Links

HGNC: 16667

OMIM: 611028

KEGG: hsa:55754

STRING: 9606.ENSP00000230461

UniGene: Hs.108530

Protein Families
CDC50/LEM3 family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell membrane. Golgi apparatus. Cytoplasmic vesicle, secretory vesicle membrane. Apical cell membrane.

Q&A

What is TMEM30A and what are its primary functions in cellular biology?

TMEM30A functions as the β-subunit of P4-ATPase phospholipid flippases. These enzymatic complexes play essential roles in:

  • Maintaining asymmetric distribution of phospholipids across cell membranes

  • Stabilizing cell membrane structure

  • Facilitating vesicle-protein transport

  • Regulating membrane-protein functions

  • Cell polarity establishment

  • Recognition of cell apoptosis and differentiation

TMEM30A is widely expressed in multiple organs including brain, lung, cerebellum, liver, kidney, spine, and testicles, suggesting its fundamental importance in cellular homeostasis .

How is TMEM30A expression regulated in different tissues?

TMEM30A expression patterns vary significantly across tissues. While TMEM30A and TMEM30B are widely expressed throughout the body, TMEM30C expression is restricted to the testes and brain . Research indicates that TMEM30A expression is responsive to growth factor stimulation, with its levels oscillating through the cell cycle and reaching peak expression during S phase .

In specific tissues, expression patterns show tissue-specific regulation:

Tissue TypeTMEM30A Expression PatternAssociated Function
Brain/Neural TissueHigh expression in hippocampal neuronsAxonal development, neuronal differentiation
Pancreatic β-cellsSignificant expressionInsulin secretion, glucose metabolism
Kidney (Podocytes)High expressionGlomerular filtration, prevention of FSGS

To analyze tissue-specific expression, immunohistochemistry or fluorescence microscopy using TMEM30A-specific antibodies is recommended, with co-staining for tissue-specific markers (e.g., insulin for β-cells) .

What experimental approaches are recommended for studying TMEM30A in vitro?

For researchers beginning work with TMEM30A, the following methodological approaches are recommended:

  • Expression analysis: Real-time PCR and Western blot analysis for quantitative assessment of mRNA and protein levels respectively

  • Immunofluorescence (IF) staining: For subcellular localization studies. Double-staining with organelle markers can reveal TMEM30A's distribution pattern

  • Knockdown studies: shRNA-mediated knockdown of TMEM30A can be performed in cell lines to study loss-of-function effects

  • Rescue experiments: Creating shTmem30a-resistant cDNA (resTmem30a) to validate specificity of knockdown phenotypes

  • Co-immunoprecipitation: To identify protein interaction partners of TMEM30A, particularly its relationship with various P4-ATPase α-subunits

When designing knockdown experiments, it's important to validate specificity with multiple shRNA constructs and include appropriate rescue controls to confirm observed phenotypes are directly related to TMEM30A depletion rather than off-target effects .

How does TMEM30A contribute to metabolic regulation through glycolytic pathways?

Recent transcriptomic and metabolomic analyses have revealed that TMEM30A plays a crucial role in regulating glycolysis. TMEM30A knockdown leads to significant downregulation of key glycolytic enzymes including:

  • ALDOA (Aldolase A)

  • HK2 (Hexokinase 2)

  • LDHA (Lactate Dehydrogenase A)

  • GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase)

This metabolic dysregulation appears to be a critical mechanism underlying cellular dysfunction in models of TMEM30A deficiency. The pathway analysis revealed that differential gene expression primarily affected:

  • Glycolysis/gluconeogenesis pathways

  • Glutathione metabolism

  • Drug metabolism (cytochrome P450)

  • Purine metabolism

  • Glycerophospholipid metabolism

For researchers investigating this connection, integrative multi-omics approaches combining transcriptomics and metabolomics, followed by pathway enrichment analysis (Gene Ontology, KEGG, GSEA), are recommended to comprehensively map the metabolic networks affected by TMEM30A modulation .

What are the optimal methods for generating and validating TMEM30A conditional knockout models?

Creating effective conditional knockout models for TMEM30A requires careful consideration of both genetic strategy and validation approaches:

Generation strategies:

  • Cre-loxP system with tissue-specific promoters (e.g., NPHS2-Cre for podocyte-specific deletion or Insulin promoter-driven Cre for β-cell-specific deletion)

  • Temporal control using inducible Cre systems (e.g., tamoxifen-inducible CreERT2) to avoid developmental compensation

Validation methodologies:

  • Genomic PCR to confirm recombination

  • qRT-PCR to verify reduced mRNA expression

  • Western blot analysis to confirm protein depletion

  • Immunohistochemistry to visualize tissue-specific loss of expression

  • Functional assays specific to the tissue being studied

When characterizing the phenotype of conditional knockouts, it is essential to examine tissue-specific functional parameters. For instance, in pancreatic β-cell-specific Tmem30a knockout mice, researchers should assess:

  • Glucose tolerance tests

  • Insulin secretion capacity

  • β-cell mass and morphology

  • Markers of ER stress

  • Insulin granule formation and trafficking

How can researchers effectively measure phospholipid flipping activity associated with TMEM30A function?

Measuring phospholipid flipping activity is critical for functional analysis of TMEM30A. Several methodological approaches can be employed:

  • NBD-labeled phospholipid assays: Using fluorescently labeled phospholipids (NBD-PS, NBD-PE) to track transmembrane movement. After incorporation of the labeled lipids into the outer leaflet, flippase activity is measured by the appearance of the fluorescent lipid in the inner leaflet.

  • Flow cytometry with Annexin V: To assess phosphatidylserine exposure on the cell surface, which increases when TMEM30A function is compromised.

  • Mass spectrometry-based lipidomics: For comprehensive analysis of phospholipid distribution across membrane leaflets in TMEM30A-deficient versus control cells.

  • ATP consumption assays: Since P4-ATPases require ATP hydrolysis for flipping activity, measuring ATP consumption in membrane preparations can provide indirect measurement of flippase activity.

These techniques can be complemented with microscopy approaches to visualize membrane asymmetry disturbances in real-time when TMEM30A function is perturbed .

What mechanisms underlie TMEM30A's role in vesicular transport and protein trafficking?

TMEM30A is essential for clathrin-mediated vesicle transport between the trans-Golgi network (TGN) and plasma membrane. Research indicates several mechanistic components:

  • Membrane curvature regulation: TMEM30A-associated phospholipid flipping generates asymmetry that facilitates membrane curvature required for vesicle budding.

  • Protein trafficking pathways: In pancreatic β cells, TMEM30A regulates:

    • Insulin secretory granule budding from the TGN

    • Transport of glucose transporter 2 (Glut2) to the plasma membrane

  • Interaction with trafficking machinery: TMEM30A likely interfaces with components of the vesicular trafficking machinery including:

    • Clathrin adaptor proteins

    • Small GTPases involved in vesicle formation

    • Components of the SNARE complex for membrane fusion events

Methodologically, researchers investigating these pathways should consider:

  • Live-cell imaging with fluorescently tagged cargo proteins

  • Electron microscopy to visualize vesicle morphology and distribution

  • Co-immunoprecipitation studies to identify interaction partners in the trafficking machinery

  • Pulse-chase experiments to track protein trafficking kinetics

Disruption of these mechanisms through TMEM30A depletion leads to impaired protein transport and secretion defects, as evidenced in β cells where insulin secretion is compromised .

What are the best approaches for studying TMEM30A function in primary cells versus cell lines?

Different experimental systems require tailored approaches:

Primary Cell Systems:

  • Isolation protocols must be optimized for cell type (e.g., podocytes from kidney, β cells from pancreatic islets)

  • Shorter experimental windows due to limited culture viability

  • Nucleofection often provides better transfection efficiency than lipid-based methods

  • Adenoviral or lentiviral transduction systems are recommended for genetic manipulation

  • Physiologically relevant but higher variability between preparations

Cell Line Models:

  • Immortalized podocyte cell lines and INS-1 (β cell) lines are established models

  • Stable knockdown/knockout cell lines can be generated using CRISPR-Cas9 or shRNA

  • Higher transfection efficiency and experimental reproducibility

  • May lack some tissue-specific regulatory mechanisms

For either system, validation of findings across multiple experimental platforms is recommended. When possible, findings from cell line studies should be confirmed in primary cells and ultimately in animal models to establish physiological relevance .

How can researchers effectively analyze TMEM30A's role in disease models like FSGS or diabetes?

When investigating TMEM30A in disease contexts, a multi-level experimental approach is recommended:

For FSGS models:

  • Patient samples: Compare TMEM30A expression in kidney biopsies from FSGS patients versus controls using immunohistochemistry

  • Animal models: Utilize podocyte-specific Tmem30a knockout mice (Tmem30a LoxP/LoxP; NPHS2-Cre) to study disease progression

  • Cellular models: Tmem30a knockdown in cultured podocytes to investigate molecular mechanisms

  • Molecular readouts: Monitor podocyte-specific markers (Synaptopodin, WT1) and glycolysis-related molecules (ALDOA, HK2, LDHA, GAPDH)

  • Functional assays: Albuminuria measurements, podocyte migration/adhesion assays

For diabetes models:

  • Metabolic phenotyping: Glucose tolerance tests, insulin tolerance tests, and in vivo glucose-stimulated insulin secretion

  • Islet isolation: To study ex vivo insulin secretion from β-cell-specific Tmem30a knockout mice

  • Vesicular trafficking analysis: Track insulin granule formation and movement using fluorescently tagged insulin

  • Glucose uptake assays: Measure Glut2 trafficking to plasma membrane

In both disease models, researchers should consider combining:

  • Single-cell transcriptomics to capture cell-specific responses

  • Proteomics to identify altered protein networks

  • Metabolomics to capture metabolic pathway dysregulation

  • In vivo rescue experiments to confirm causality

What are the most reliable antibodies and reagents for TMEM30A research, and how should they be validated?

Selecting appropriate reagents is critical for reliable TMEM30A research:

Antibodies:
Several commercial antibodies are available, but validation is essential:

ApplicationRecommended Antibody Validation
Western Blot1. Compare bands from control vs. knockdown samples
2. Verify molecular weight (approximately 37 kDa)
3. Test multiple antibodies targeting different epitopes
Immunofluorescence1. Include secondary-only controls
2. Verify specificity with knockdown samples
3. Confirm co-localization with expected organelle markers
Immunoprecipitation1. Validate by mass spectrometry
2. Confirm specific pulldown with reverse IP

Genetic Tools:

  • For knockdown studies, at least 2-3 independent shRNA/siRNA constructs should be tested

  • For CRISPR-Cas9 knockout, multiple guide RNAs should be designed and validated by sequencing

  • Rescue constructs should be engineered with silent mutations to resist shRNA/siRNA

Expression Vectors:

  • Full-length human TMEM30A cDNA is available in various expression vectors

  • When overexpressing, verify expression levels fall within physiological range

  • Consider epitope-tagged versions (FLAG, HA, GFP) for tracking, but validate that tags don't interfere with function

All reagents should be validated across multiple experimental systems and batches to ensure reproducibility .

How should researchers interpret conflicting data between in vitro and in vivo TMEM30A studies?

When facing discrepancies between in vitro and in vivo findings, consider these analytical approaches:

  • Systematic analysis of differences between models:

    • Cell lines may lack tissue-specific regulators present in vivo

    • Acute knockdown effects (in vitro) may differ from developmental compensation in knockout models

    • Timing differences: in vitro studies capture immediate responses while in vivo models reflect longer-term adaptations

  • Reconciliation strategies:

    • Temporal analysis: Track changes over time in both systems

    • Dose-dependency: Analyze partial versus complete loss of function

    • Tissue context: Determine if discrepancies are tissue-specific

    • Signaling network analysis: Map broader pathway alterations that might explain differences

  • Methodological approaches to resolve conflicts:

    • Conduct inducible knockout studies to better match acute in vitro depletion

    • Perform ex vivo studies with tissues from in vivo models

    • Use more physiologically relevant in vitro systems (organoids, co-cultures)

    • Validate key molecular readouts using multiple independent techniques

For example, if glycolytic enzyme changes observed in cultured podocytes after TMEM30A knockdown don't match the magnitude seen in podocyte-specific knockout mice, consider analyzing developmental stage differences, compensatory mechanisms, or cell-extrinsic factors present in the in vivo environment .

What are potential pitfalls in analyzing multi-omics data from TMEM30A studies, and how can they be avoided?

Multi-omics studies of TMEM30A function present several analytical challenges:

Common Pitfalls:

  • Integration difficulties:

    • Transcriptomic and metabolomic data operate on different timescales

    • Protein changes may not directly correlate with transcript alterations

    • Metabolite changes reflect both production and consumption rates

  • Pathway enrichment biases:

    • Over-representation of well-characterized pathways

    • Missing tissue-specific metabolic pathways

    • Failure to capture novel or non-canonical functions

  • Causality determination:

    • Distinguishing primary from secondary effects

    • Circular regulation between metabolism and gene expression

    • Compensatory mechanisms masking direct effects

Recommended Solutions:

  • Experimental design improvements:

    • Include multiple time points to capture dynamic changes

    • Use multiple genetic perturbation strategies (knockdown, knockout, overexpression)

    • Include rescue experiments to establish causality

  • Analytical approaches:

    • Apply integrated pathway analysis tools (e.g., MetaboAnalyst, IMPaLA)

    • Use network-based approaches that connect transcripts, proteins, and metabolites

    • Employ systems biology modeling to predict causal relationships

    • Validate key nodes through targeted biochemical assays

  • Validation strategies:

    • Perform targeted metabolic flux analysis using labeled substrates

    • Test pathway interventions with specific inhibitors

    • Generate compound genetic models to test pathway relationships

The study of TMEM30A's role in glycolysis provides an example: transcriptomic and metabolomic analyses suggested glycolytic pathway involvement, which was then validated through targeted analysis of key enzymes (ALDOA, HK2, LDHA, GAPDH) at both mRNA and protein levels, and further confirmed through rescue experiments .

What are the most critical controls needed when performing TMEM30A knockdown or knockout experiments?

Rigorous controls are essential for reliable interpretation of TMEM30A functional studies:

For Knockdown Studies:

  • Non-targeting controls: Multiple non-targeting shRNA/siRNA constructs that undergo the same delivery method

  • Rescue controls: Expression of shRNA/siRNA-resistant TMEM30A cDNA to restore function

  • Off-target validation: Use multiple knockdown constructs targeting different regions of TMEM30A

  • Knockdown efficiency verification: Quantification at both mRNA and protein levels

  • Temporal controls: Analysis at multiple time points to distinguish acute versus adaptive responses

For Knockout Studies:

  • Littermate controls: Use of proper genetic background-matched controls

  • Tissue-specificity validation: Confirm knockout is restricted to target tissue

  • Conditional systems: Use of inducible systems to control timing of deletion

  • Compensatory mechanism assessment: Analysis of related family members (TMEM30B, TMEM30C) that might compensate

  • Mosaic analysis: When possible, analyze cells with and without knockout in the same tissue

Functional Validation Controls:

  • Dose-dependency tests: Analysis of phenotypes with varying degrees of TMEM30A depletion

  • Downstream pathway validation: Confirm expected changes in P4-ATPase function and phospholipid asymmetry

  • Specificity controls: Demonstrate that phenotypes are not due to general membrane disruption

  • Positive controls: Include known modulators of the pathways being studied

For example, in the study of TMEM30A's role in podocyte injury, researchers created a shTmem30a-resistant cDNA (resTmem30a) that could partially reverse the downregulation of both podocyte-related molecules and glycolysis-related molecules, confirming specificity of the observed effects .

What are the most promising therapeutic applications emerging from TMEM30A research?

Based on current understanding of TMEM30A functions, several therapeutic approaches show potential:

  • For podocyte-related kidney diseases:

    • Small molecule activators of glycolytic enzymes could potentially compensate for TMEM30A deficiency

    • Targeted delivery of glycolytic pathway components to podocytes

    • Development of phospholipid flippase activators to restore membrane asymmetry

    • Exploration of metabolic reprogramming strategies to bypass glycolytic defects

  • For metabolic disorders:

    • Modulation of TMEM30A activity in pancreatic β cells could enhance insulin secretion

    • Therapeutic approaches targeting vesicular trafficking to improve insulin granule formation

    • Development of agents that promote Glut2 trafficking to membrane in β cells

  • For neurodegenerative conditions:

    • Given TMEM30A's role in neuronal differentiation and axon development, therapies targeting neuronal TMEM30A function could have applications in neurodegeneration

    • Preservation of membrane asymmetry to prevent neuronal death

Research methodologies to explore these therapeutic directions should include:

  • High-throughput screening for modulators of TMEM30A activity

  • Structural studies to enable rational drug design

  • Development of tissue-specific delivery systems

  • In vivo validation in relevant disease models

What technical innovations are needed to advance understanding of TMEM30A's structural biology and interaction network?

Several technical advances would significantly enhance TMEM30A research:

  • Structural biology approaches:

    • Cryo-EM studies of the complete P4-ATPase-TMEM30A complex in different conformational states

    • X-ray crystallography of TMEM30A domains to identify critical functional regions

    • NMR studies of TMEM30A-lipid interactions

    • Molecular dynamics simulations to model flippase activity

  • Interactome analysis technologies:

    • Proximity labeling approaches (BioID, APEX) to identify tissue-specific interaction partners

    • Cross-linking mass spectrometry to map protein-protein interfaces

    • Single-molecule imaging to visualize TMEM30A complexes in living cells

    • Organelle-specific interactome analysis to identify compartment-specific functions

  • Functional genomics tools:

    • Development of domain-specific TMEM30A mutants to dissect function

    • Tissue-specific and temporally controlled gene editing strategies

    • Single-cell multi-omics approaches to map heterogeneity in TMEM30A function

    • Genetic interaction screens to identify synthetic lethal/viable partners

These technologies would help address remaining questions about how TMEM30A structurally interacts with different P4-ATPase α-subunits, how its activity is regulated in different cellular contexts, and how it coordinates vesicular trafficking with membrane phospholipid asymmetry .

What are the most important unanswered questions regarding TMEM30A biology?

Despite significant advances, several fundamental questions about TMEM30A remain unanswered:

  • Regulatory mechanisms:

    • How is TMEM30A expression and activity regulated across different tissues?

    • What post-translational modifications control TMEM30A function?

    • How do cells compensate for TMEM30A deficiency in different contexts?

  • Functional specificity:

    • How does TMEM30A achieve specificity for different P4-ATPase α-subunits?

    • What determines the tissue-specific functions of TMEM30A?

    • Why can't TMEM30B compensate for TMEM30A loss in most tissues?

  • Metabolic control mechanisms:

    • How does TMEM30A regulate glycolytic enzyme expression and activity?

    • Is the connection between phospholipid flipping and metabolic regulation direct or indirect?

    • What signaling pathways link TMEM30A function to transcriptional control of metabolic genes?

  • Disease relevance:

    • Are TMEM30A mutations or expression changes associated with human diseases beyond FSGS?

    • Could TMEM30A be a biomarker for early detection of podocyte injury or β-cell dysfunction?

    • How does TMEM30A contribute to age-related metabolic decline?

Addressing these questions will require integrative approaches combining conditional genetic models, advanced imaging techniques, multi-omics profiling, and computational modeling. Additionally, translational studies examining TMEM30A expression and function in human patient samples will be crucial for establishing clinical relevance .

What are the best practices for validating TMEM30A-related findings across different experimental systems?

To ensure robust and reproducible TMEM30A research, consider these validation approaches:

  • Cross-platform validation:

    • Verify key findings using multiple technical approaches (e.g., both Western blot and immunofluorescence for protein expression)

    • Confirm functional outcomes using complementary assays (e.g., both metabolite measurements and enzymatic activity assays)

  • Cross-model validation:

    • Test hypotheses in multiple cell types/lines

    • Validate cell culture findings in primary cells

    • Confirm in vitro observations in appropriate in vivo models

    • When possible, examine human patient samples

  • Genetic validation strategies:

    • Use both loss-of-function (knockout/knockdown) and gain-of-function (overexpression) approaches

    • Employ rescue experiments with wild-type and mutant constructs

    • Generate compound genetic models to test pathway relationships

  • Technical considerations:

    • Include appropriate positive and negative controls in all experiments

    • Blind analysis where possible to avoid confirmation bias

    • Use sufficient biological and technical replicates

    • Apply appropriate statistical analyses

    • Share detailed protocols and reagent information

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.