Recombinant Human Cell cycle control protein 50C (TMEM30C)

Shipped with Ice Packs
In Stock

Description

Cell Cycle Regulation

TMEM30C interacts with P4-ATPases to regulate phospholipid translocation, a process critical for membrane integrity during cell division . Studies suggest its role in G1/S phase progression, though direct mechanistic data remain limited .

Detection and Assays

  • ELISA: A commercial kit detects TMEM30C with <8% intra-assay variability and <10% inter-assay variability .

  • Western Blot: Anti-TMEM30C antibodies (e.g., SAB4501289) are validated for immunofluorescence and ELISA .

Comparative Analysis Across Species

TMEM30C homologs are conserved in mammals:

SpeciesUniProt IDRecombinant Product Availability
Human (Homo sapiens)A0ZSE6Full-length, His-tagged
Mouse (Mus musculus)Q9D4D7Partial-length, mammalian cell-expressed
Chimpanzee (Pan troglodytes)N/AE. coli-expressed (CSB-CF023827EQV)

Source:

Stability and Quality Control

  • Thermal Stability: Maintains integrity after lyophilization and reconstitution .

  • Glycosylation: Recombinant TMEM30C lacks post-translational modifications due to prokaryotic expression, contrasting with native mammalian forms .

Research Limitations and Future Directions

While TMEM30C’s structural data are well-characterized, its precise role in cell cycle control requires further study. Current gaps include:

  • Interaction partners beyond P4-ATPases.

  • Mechanistic links between lipid transport and cell cycle checkpoints.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us and we will prioritize development according to your request.
Synonyms
TMEM30CP; CDC50C; TMEM30C; Cell cycle control protein 50C; Transmembrane protein 30C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM30CP
Target Protein Sequence
MEERAQHCLSRLLDNSALKQQELPIHRLYFTARRVLFVFFATGIFCLCMGIILILSARSTQEIEINYTRICANCAKLRENASNFDKECTCSIPFYLSGKMMVGEIQETRLTLH
Uniprot No.

Target Background

Database Links

HGNC: 30443

OMIM: 611030

STRING: 9606.ENSP00000402698

UniGene: Hs.652353

Protein Families
CDC50/LEM3 family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Specifically expressed in testis.

Q&A

What is the molecular structure and basic function of TMEM30C?

TMEM30C (Transmembrane Protein 30C) belongs to the CDC50/LEM3 family of proteins that function as essential subunits for P4-type ATPases (phospholipid flippases). The protein likely contains multiple transmembrane domains with both extracellular and cytoplasmic regions that facilitate membrane integration and protein-protein interactions. Based on structural similarities with other family members, TMEM30C likely plays a role in maintaining membrane asymmetry and cellular signaling pathways related to cell cycle progression.

The molecular function appears to involve heterodimerization with specific ATPases to create functional complexes that regulate phospholipid distribution across membrane bilayers. This activity is critical for membrane homeostasis and may influence multiple cellular processes including signaling cascades that control cell division .

How does TMEM30C relate to other members of the TMEM30 family?

TMEM30C shares structural and functional similarities with TMEM30A and TMEM30B, though each has distinct expression patterns and potentially specialized roles. TMEM30A has been more extensively characterized and serves as a model for understanding TMEM30C function.

Research on TMEM30A reveals it forms heterodimeric complexes with P4-ATPases that are crucial for proper membrane flippase activity. TMEM30A loss-of-function mutations increase B-cell receptor (BCR) mobility and signaling, suggesting a role in regulating receptor dynamics on the cell surface . By extension, TMEM30C may have similar capabilities in regulating membrane protein dynamics but in different cellular contexts or tissues.

The evolutionary conservation of multiple TMEM30 family members suggests distinct biological roles that complement each other, with TMEM30C potentially having unique functions that deserve specific investigation.

What evidence connects TMEM30C to cell cycle regulation mechanisms?

While direct evidence specifically linking TMEM30C to cell cycle regulation remains limited, correlation studies have shown a significant relationship between TMEM30C and SEMA3B-AS1 (r = 0.41, p = 1.5 × 10^-6) . This correlation suggests potential involvement in regulatory networks that may influence cell proliferation.

Research on related protein TMEM30A shows its loss-of-function increases B-cell receptor signaling following antigen stimulation, potentially conferring selective advantage during lymphoma development . By extension, TMEM30C may similarly influence signaling pathways involved in cell cycle control, though possibly in different cellular contexts.

The relationship between TMEM30C and cyclin-dependent kinases (CDKs) – master regulators of cell cycle progression – remains to be elucidated . Experimental approaches to investigate this connection should include co-immunoprecipitation studies, proximity labeling techniques, and transcriptome analysis following TMEM30C perturbation to identify regulatory relationships.

How should researchers design loss-of-function studies for TMEM30C?

When designing TMEM30C loss-of-function studies, researchers should consider several methodological approaches:

  • CRISPR-Cas9 gene editing: Create complete knockout cell lines by targeting coding regions of TMEM30C. Researchers should design multiple guide RNAs targeting different exons to control for off-target effects. Phenotypic validation should include rescue experiments with wild-type TMEM30C expression.

  • RNA interference: Use siRNA or shRNA approaches for temporary or stable knockdown, which allows for studying dose-dependent effects and avoids potential compensatory mechanisms that might arise in complete knockout systems.

  • Domain-specific mutations: Based on TMEM30A studies, researchers should consider creating specific mutations affecting:

    • Glycosylation sites that influence heterodimer formation with ATPases

    • Transmembrane domains critical for membrane insertion

    • Cytoplasmic regions that may mediate signaling interactions

Studies on TMEM30A have shown that truncated mutants (e.g., R226X, R290X, R307X) failed to precipitate with ATP8A2, suggesting a failure to form functional complexes . Similar approaches could identify critical domains in TMEM30C.

What experimental systems are most appropriate for studying TMEM30C function?

The choice of experimental system depends on the specific aspect of TMEM30C biology being investigated:

  • Cell line models:

    • Human cancer cell lines with endogenous TMEM30C expression

    • Paired knockout/wildtype lines generated using CRISPR-Cas9

    • Systems with inducible TMEM30C expression to study time-dependent effects

  • Primary cell models:

    • Primary human cells from tissues with high TMEM30C expression

    • Patient-derived cells harboring naturally occurring TMEM30C variants

  • Biochemical systems:

    • Reconstituted membrane systems with purified TMEM30C and potential partner proteins

    • In vitro flippase activity assays using fluorescent lipid analogs

  • Correlation studies:

    • Expression correlation analysis, similar to the identified relationship between TMEM30C and SEMA3B-AS1 (r = 0.41, p = 1.5 × 10^-6)

When studying potential correlations between TMEM30C and other genes, researchers should consider using statistical methods designed for analysis of transcriptomic data, similar to those used in microarray studies .

How might TMEM30C dysfunction contribute to disease pathogenesis?

Based on studies of TMEM30A, which functions as a tumor suppressor in B-cell lymphoma , TMEM30C dysfunction may similarly contribute to disease through altered membrane homeostasis and signaling. Potential mechanisms include:

  • Altered phospholipid distribution: Disruption of membrane asymmetry could affect receptor clustering and signaling pathway activation.

  • Dysregulated cell signaling: Changes in membrane composition may alter the activity of membrane-associated signaling complexes that control cell proliferation.

  • Aberrant gene regulation: The correlation between TMEM30C and SEMA3B-AS1 (r = 0.41) suggests potential involvement in gene regulatory networks that, when disrupted, may contribute to disease.

Researchers investigating TMEM30C in disease contexts should consider:

  • Expression analysis in patient samples compared to healthy controls

  • Correlation with clinical outcomes and disease progression

  • Functional studies in disease models to establish causality

  • Analysis of genetic variants and their association with disease risk

What are optimal protocols for expressing and purifying recombinant TMEM30C?

Successful expression and purification of functional TMEM30C requires careful consideration of several factors:

Expression Systems:

  • Mammalian cells: HEK293T or CHO cells are preferable for maintaining proper post-translational modifications, particularly glycosylation, which is critical for TMEM30 family protein function .

  • Construct design:

    • Include affinity tags (His6, FLAG) positioned to avoid interference with function

    • Consider codon optimization for the chosen expression system

    • For co-expression studies, design constructs that allow for co-expression with potential partner P4-ATPases

Purification Strategy:

  • Membrane extraction: Use mild detergents (DDM, LMNG) to solubilize TMEM30C while preserving structure

  • Affinity chromatography: Capture using tag-based purification

  • Size exclusion chromatography: Further purify protein complexes

  • Reconstitution: Consider nanodiscs or liposomes for functional studies

Quality Control:

  • Verify glycosylation status: Using PNGase F treatment and gel shift assays

  • Assess complex formation: Using co-immunoprecipitation with potential ATPase partners

  • Confirm function: Develop flippase activity assays with fluorescent lipid analogs

Based on TMEM30A studies, researchers should monitor glycosylation status carefully, as this modification is necessary for normal complex formation and activity .

What approaches can quantify TMEM30C-associated flippase activity?

To measure TMEM30C-associated flippase activity, researchers can adapt methods used for other TMEM30 family proteins:

  • Fluorescent lipid translocation assays:

    • Use NBD-labeled phospholipids to monitor their translocation across membranes

    • Measure fluorescence changes upon addition of membrane-impermeant reducing agents that quench fluorescence selectively on the outer leaflet

    • Compare flippase activity in TMEM30C-expressing versus knockout cells

  • Flow cytometry-based approaches:

    • Label cells with fluorescent phospholipid analogs

    • Measure fluorescence intensity changes over time

    • Analyze fluorescence distribution in different cell populations

  • Reconstituted systems:

    • Incorporate purified TMEM30C and partner ATPases into liposomes

    • Monitor ATP-dependent lipid translocation using fluorescence spectroscopy

    • Assess the effects of mutations or small molecule inhibitors

  • Phosphatidylserine exposure assays:

    • Use Annexin V binding to detect PS exposure on the cell surface

    • Compare PS exposure in wildtype versus TMEM30C-deficient cells

When interpreting results, researchers should consider that membrane asymmetry may influence multiple cellular processes beyond direct flippase activity, including receptor clustering and signaling pathway activation.

How should researchers analyze TMEM30C expression data in experimental studies?

When analyzing TMEM30C expression data, researchers should address several key considerations:

  • Technical considerations:

    • Primer/antibody specificity: Ensure tools can distinguish TMEM30C from other family members

    • Reference gene selection: Choose stable reference genes for qPCR normalization

    • Sample processing: Standardize protocols to minimize technical variability

  • Statistical approaches:

    • For correlation studies (like the TMEM30C-SEMA3B-AS1 correlation, r = 0.41) , use appropriate correlation coefficients (Pearson, Spearman) depending on data distribution

    • Consider multiple testing corrections when analyzing genome-wide data

    • When evaluating false discovery rates in large-scale studies, follow approaches similar to those described for microarray analysis

  • Data presentation:

    • Present raw data alongside normalized results when possible

    • Include appropriate statistical analysis and sample sizes

    • Clearly state the methods used for quantification and normalization

  • Interpretation considerations:

    • Distinguish between correlation and causation

    • Consider cell type specificity and context dependency

    • Evaluate whether expression changes reflect altered transcription, RNA stability, or protein stability

  • Validation approaches:

    • Use multiple techniques (qPCR, western blot, immunohistochemistry) to confirm expression changes

    • Validate findings across different experimental models

What methods are most effective for studying TMEM30C interactions with potential partner proteins?

To investigate TMEM30C protein interactions, researchers should employ multiple complementary approaches:

  • Affinity-based methods:

    • Co-immunoprecipitation (Co-IP): Using antibodies against TMEM30C or its tagged version

    • Pull-down assays: With recombinant TMEM30C as bait

    • Tandem Affinity Purification (TAP): For identifying stable protein complexes

  • Proximity-based methods:

    • BioID: Fusion of TMEM30C with a biotin ligase to identify proximal proteins

    • APEX2: Enzyme-catalyzed proximity labeling in living cells

    • Cross-linking Mass Spectrometry: To capture transient interactions

  • Live-cell interaction assays:

    • FRET: For direct protein-protein interactions

    • BiFC: To visualize interaction partners

    • Split-luciferase assays: For quantitative measurement of interactions

  • RNA-protein interaction methods (for studying TMEM30C-SEMA3B-AS1 correlation):

    • RNA immunoprecipitation (RIP): To identify direct RNA-protein interactions

    • CLIP-seq: To map RNA-binding sites with nucleotide resolution

When investigating the correlation between TMEM30C and SEMA3B-AS1 (r = 0.41, p = 1.5 × 10^-6) , researchers should consider both direct interactions and indirect regulatory relationships mediated through shared regulatory factors.

How should researchers interpret correlation data between TMEM30C and other genes?

When interpreting correlation data such as that between TMEM30C and SEMA3B-AS1 (r = 0.41, p = 1.5 × 10^-6) , researchers should consider:

  • Statistical significance versus biological significance:

    • Evaluate both the strength of correlation (r value) and statistical significance (p-value)

    • Consider whether the correlation magnitude suggests a meaningful biological relationship

  • Potential relationship mechanisms:

    • Co-regulation by shared transcription factors

    • Direct regulatory relationships (one gene regulating the other)

    • Functional relationships in shared biological pathways

    • Indirect associations due to common cellular processes

  • Context dependency:

    • Tissue or cell-type specificity of the correlation

    • Changes in correlation patterns under different conditions

    • Developmental or disease-specific correlation patterns

  • Validation approaches:

    • Experimental manipulation of one gene to observe effects on the other

    • Analysis of correlation in independent datasets

    • Functional studies to identify shared biological roles

The correlation table below summarizes the relationship between TMEM30C and SEMA3B-AS1:

mRNAlncRNACorrelation Coefficient (r<sub>s</sub>)p-ValueNumber of Complementary NucleotidesProportion
TMEM30CSEMA3B-AS10.411.5 × 10<sup>-6</sup>80.025

This correlation suggests a potential regulatory relationship that warrants further investigation through experimental approaches .

What considerations are important when comparing TMEM30C with other TMEM30 family members?

When comparing TMEM30C with other TMEM30 family proteins (particularly the better-characterized TMEM30A), researchers should consider:

  • Structural similarities and differences:

    • Conserved domains that suggest shared functions

    • Unique regions that may confer specific functions

    • Post-translational modifications that affect activity

  • Expression patterns:

    • Tissue-specific expression differences

    • Cell type-specific expression patterns

    • Changes in expression during development or disease

  • Functional overlap and specialization:

    • Shared partner proteins versus unique interactions

    • Complementary versus redundant cellular roles

    • Effects of knockdown or knockout on cellular physiology

  • Evolutionary conservation:

    • Sequence conservation across species

    • Gene duplication and diversification patterns

    • Selective pressures indicating functional importance

Based on TMEM30A studies, researchers should particularly focus on:

  • Complex formation with P4-ATPases

  • Effects on membrane protein mobility and signaling

  • Potential tumor suppressor functions

TMEM30A loss-of-function mutations have been shown to drive lymphomagenesis while conferring vulnerability to immunochemotherapy, suggesting complex roles in both disease development and treatment response .

What statistical methods are most appropriate for analyzing TMEM30C experimental data?

When analyzing TMEM30C experimental data, researchers should select statistical methods appropriate to their specific experimental design:

  • For gene expression comparisons:

    • t-tests or ANOVA: For comparing expression levels between groups

    • Linear regression: For identifying relationships with continuous variables

    • FDR correction methods: For controlling false discoveries in multiple comparisons

  • For correlation analyses:

    • Pearson correlation: For linear relationships between normally distributed variables

    • Spearman correlation: For monotonic relationships without assuming normality

    • Multiple regression: For controlling confounding variables

  • For high-throughput data:

    • FDR control methods: Similar to those described for microarray analysis to control false discovery rates at desired levels (5%, 10%, 15%, or 20%)

    • Integrative analysis approaches: To combine multiple data types

    • Pathway enrichment analysis: To identify biological processes affected by TMEM30C

  • For functional studies:

    • Survival analysis: For time-to-event data in disease models

    • Repeated measures ANOVA: For time-course experiments

    • Mixed-effects models: For complex experimental designs with multiple sources of variation

When controlling for multiple testing, researchers should consider that different FDR thresholds may be appropriate for different research questions, as demonstrated in the simulation study where FDR control at 5%, 10%, 15%, and 20% yielded gene lists of varying sizes and actual false positive fractions .

What are promising therapeutic applications of TMEM30C research?

Based on findings from the related protein TMEM30A, several therapeutic applications of TMEM30C research warrant investigation:

  • Cancer therapy sensitization:

    • TMEM30A loss-of-function mutations increase accumulation of chemotherapy drugs in lymphoma cells

    • TMEM30C modulation might similarly enhance drug uptake in treatment-resistant cancers

    • Small molecule inhibitors of TMEM30C could potentially sensitize cancer cells to existing therapies

  • Immunotherapy enhancement:

    • TMEM30A loss increases tumor-associated macrophage infiltration and enhances anti-CD47 blockade effects

    • TMEM30C inhibition might similarly modulate the tumor immune microenvironment

    • Combination approaches pairing TMEM30C targeting with immune checkpoint inhibitors could be explored

  • Targeted therapy approaches:

    • Synthetic lethality strategies might exploit vulnerabilities created by TMEM30C alterations

    • Cell type-specific targeting could leverage tissue-specific expression patterns

    • Lipid flippase modulation could create novel therapeutic windows

  • Biomarker development:

    • TMEM30C expression or mutation status might predict treatment response

    • The correlation with SEMA3B-AS1 could be developed into a diagnostic or prognostic signature

Future therapeutic development should consider both the potential tumor-promoting and tumor-suppressing roles that TMEM30C might play in different contexts, similar to the complex roles observed for TMEM30A in lymphomagenesis and treatment response .

What experimental design principles should guide future TMEM30C research?

Future TMEM30C research would benefit from adhering to several key experimental design principles:

  • Comprehensive characterization:

    • Define tissue-specific expression patterns

    • Identify interacting partners and regulatory relationships

    • Characterize effects of genetic alterations on cellular physiology

  • Appropriate controls and replication:

    • Use biological replication rather than just technical replication

    • Include isogenic cell lines that differ only in TMEM30C status

    • Validate findings across multiple experimental systems

  • Integrated multi-omics approaches:

    • Combine transcriptomic, proteomic, and functional data

    • Perform integrative mutation-gene expression analysis similar to that used to identify TMEM30A as a putative tumor suppressor

    • Consider both cell-autonomous and non-cell-autonomous effects

  • Rigorous statistical analysis:

    • Control for multiple testing using appropriate FDR methods

    • Consider sample size calculations to ensure adequate power

    • Report both effect sizes and statistical significance

    • Present actual false positive fractions when possible, similar to the approach described for microarray analysis

  • Translational relevance:

    • Connect basic molecular mechanisms to disease processes

    • Validate findings in patient-derived samples

    • Consider therapeutic implications throughout the research process

By applying these principles, researchers can build a more complete understanding of TMEM30C biology and its potential as a therapeutic target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.