Recombinant Human Ceramide synthase 2 (CERS2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare your order according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize the development of the specified tag.
Synonyms
CERS2; LASS2; TMSG1; Ceramide synthase 2; CerS2; LAG1 longevity assurance homolog 2; SP260; Sphingosine N-acyltransferase CERS2; Tumor metastasis-suppressor gene 1 protein; Very-long-chain ceramide synthase CERS2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-380
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CERS2
Target Protein Sequence
MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIVRYFFELYV ATPLAALLNIKEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRR RRNQDRPSLLKKFREASWRFTFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQY WYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILISFSWFANYIRAGTLIMALHD SSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVILPFWILHCTLVYPLELYPAFF GYYFFNSMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSEGEEAAAGGGA KSRPLANGHPILNNNHRKND
Uniprot No.

Target Background

Function
Ceramide synthase 2 (CERS2) is an enzyme that catalyzes the transfer of the acyl chain from acyl-CoA to a sphingoid base. It exhibits high selectivity towards very-long-chain fatty acyl-CoA (chain length C22-C27). CERS2 N-acylates sphinganine and sphingosine bases to form dihydroceramides and ceramides in de novo synthesis and salvage pathways, respectively. CERS2 plays a crucial non-redundant role in the synthesis of ceramides with very-long-chain fatty acids in kidney, liver, and brain. It regulates the abundance of myelin-specific sphingolipids galactosylceramide and sulfatide, which ultimately affects myelin sheath architecture and motor neuron functions.
Gene References Into Functions
  1. Both TWIST1 and LASS2 transcripts have the potential to serve as molecular markers for bladder carcinoma. They appear to play a role in the tumorigenesis and development of bladder cancer. PMID: 30213291
  2. Research suggests that silencing ATP6V0C in highly metastatic prostate cancer (PC) cell lines inhibits V-ATPase activity. This inhibition coincides with a reduction in cell migration and invasion in vitro, as well as a significant decrease in the expression of LASS2/TMSG1, likely through a positive feedback mechanism. PMID: 29138865
  3. Utilizing CRISPR-Cas9 technology to knockdown CerS2 in cultured colon epithelial cells impaired barrier function. PMID: 28699686
  4. Low expression of LASS2 and TGFB1 is associated with the aggressiveness and poor prognosis of hepatocellular carcinoma. These factors may serve as novel prognostic biomarkers for hepatocellular carcinoma patients. PMID: 27581744
  5. ASGR1 can inhibit V-ATPase activity by interacting with LASS2, thereby suppressing the metastatic potential of hepatoma cells. PMID: 27241665
  6. Data indicates that the phosphorylation of ceramide synthases might be a key regulatory mechanism in controlling the distribution and levels of sphingolipids with varying acyl-chain lengths. PMID: 26887952
  7. Research has shown that 1-acylglycerol-3-phosphate O-acyltransferase 9 (AGPAT9) inhibits cell growth by regulating the expression of KLF4/LASS2/V-ATPase proteins in breast cancer. PMID: 26110566
  8. Findings suggest that increased miR-9 upregulation might be associated with the malignant phenotype of bladder cancer. miR-9 promotes chemoresistance in bladder cancer cells by targeting LASS2. PMID: 26150338
  9. Data reveals significant differences in CERS2 expression between various breast cancer cells, showing an inverse correlation with cell invasion. PMID: 25213553
  10. Silencing TMSG1 increased V-ATPase activity, decreased extracellular pH, and consequently activated secreted MMP-2, ultimately promoting the metastatic capacity of breast cancer cells. PMID: 25973015
  11. Research confirmed that TMSG1 is a potential metastasis suppressor gene. The mechanism involved the induction of apoptosis and inhibition of cell proliferation via a caspase-dependent mitochondrial pathway. PMID: 25735224
  12. In MCF-7 cells overexpressing LASS2/TMSG1, vacuolar ATPase (V-ATPase) activity and extracellular hydrogen ion concentration were significantly decreased, and the activity of secreted matrix metalloproteinase-2 (MMP-2) was downregulated. PMID: 25501280
  13. Research indicates that LASS2 has an inhibitory effect on the growth, invasion, and metastasis of prostate cancer cells. PMID: 24453046
  14. Co-expression of CerS2 with CerS4/CerS6 reversed the inhibitory effect of long chain ceramides on cell proliferation and the induction of apoptosis. No effect on cell proliferation was detected. PMID: 23538298
  15. Research investigated the expression and role of ceramide synthase-2 in the lung. PMID: 23690971
  16. Results support the conclusion that LASS2/TMSG1 can regulate V-ATPase activity and intracellular pH through the direct interaction of its homeodomain and the C subunit of V-ATPase. PMID: 22991218
  17. LASS2 expression may be correlated with the development and progression of human bladder carcinoma. PMID: 21755371
  18. LASS2 is implicated in chemotherapeutic outcomes, and low LASS2 expression may predict chemoresistance. PMID: 22580606
  19. Silencing LASS2 can promote invasion of prostate cancer cells in vitro through an increase in V-ATPase activity, extracellular hydrogen ion concentration, and activation of secreted MMP-2. PMID: 22178826
  20. A nucleolar localization signal has been identified within TMSG-1. PMID: 22336162
  21. Silencing LASS2/TMSG1 can promote invasion of prostate cancer cells in vitro by increasing V-ATPase activity, which accelerates tumor invasion and metastasis. This indicates that LASS2/TMSG1 acts as a novel tumor metastasis suppressor gene. PMID: 22573553
  22. The interaction of KLF6 and Sp1, along with their binding to elements in exon 1, are critical events in initiating transcription of the tmsg-1 gene. PMID: 21928351
  23. KLF6 and Sp1 may participate in the inducible transcriptional regulation of TMSG-1 in prostate carcinoma cells. PMID: 22169644
  24. TMSG-1 overexpression strongly inhibited proliferation, decreased clonogenicity of MDA-MB-231 cells, and promoted cell apoptosis. PMID: 18194600
  25. Overexpression of CerS2 resulted in partial protection from ionizing radiation-induced apoptosis. PMID: 20406683
  26. CerS2 and CerS6 mRNA were significantly elevated in breast cancer tissue compared to paired normal tissue, with approximately half of the individuals showing elevated CerS2 and CerS6 mRNA. PMID: 19912991
  27. The activity of CerS2 can be regulated by another bioactive sphingolipid, sphingosine 1-phosphate. PMID: 18165233
  28. CerS2 down-regulation had a broad effect on ceramide homeostasis, impacting not only very-long-chain ceramides but also other ceramide species. PMID: 19728861

Show More

Hide All

Database Links

HGNC: 14076

OMIM: 606920

KEGG: hsa:29956

STRING: 9606.ENSP00000271688

UniGene: Hs.744017

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in kidney, liver, brain, heart, placenta and lung.

Q&A

What is the substrate specificity of recombinant human CERS2?

Recombinant human CERS2 catalyzes the transfer of the acyl chain from acyl-CoA to a sphingoid base, with high selectivity toward very-long-chain fatty acyl-CoA (chain length C22-C27) . Unlike other ceramide synthases that have narrower substrate preferences, CERS2 can utilize a wider range of fatty acyl-CoAs but predominantly uses C22 to C24 acyl chains . This specificity is critical for the production of very-long-chain ceramides that are essential for various cellular functions, particularly in tissues like liver, kidney, and brain where CERS2 plays non-redundant roles in sphingolipid metabolism .

How should recombinant CERS2 be stored to maintain optimal activity?

For maximum stability and activity retention, recombinant human CERS2 should be stored at -80°C . The protein is typically stable for 12 months from the date of receipt under proper storage and handling conditions . It's crucial to avoid repeated freeze-thaw cycles as these can significantly diminish enzyme activity . For research applications requiring aliquoting, the protein should be divided into single-use portions immediately upon receipt and frozen at -80°C until needed. When using the protein for cell culture applications, filtration before use is recommended, although researchers should anticipate some protein loss during this process .

What expression systems are commonly used for recombinant human CERS2 production?

Several expression systems have been successfully employed for recombinant human CERS2 production, each with distinct advantages:

Expression HostTag OptionsTypical PurityApplicationsReference
HEK293TC-Myc/DDK>80%ELISA, WB, activity assays
Wheat germGSTVariableELISA, WB, AP, AA
E. coliHis>97%WB, SDS, Immunological assays
Cell-free protein synthesisStrep70-80%WB, SDS, ELISA

The HEK293T mammalian expression system is frequently preferred for functional studies as it provides proper post-translational modifications that may be critical for enzymatic activity . For structural studies requiring higher purity, E. coli-expressed protein with His-tag purification might be more suitable .

What is the recommended protocol for measuring CERS2 enzymatic activity in vitro?

A validated protocol for measuring CERS2 enzymatic activity involves the following methodology:

  • Prepare reaction mixture containing liver homogenate (or purified recombinant CERS2), 100 μM defatted BSA, 1 mM NBD-labeled sphinganine, and 5 mM 24:1 fatty acyl-CoA in a total reaction volume of 15.5 μL .

  • Incubate the reaction for 30 minutes at appropriate temperature (typically 37°C for human CERS2).

  • Terminate the reaction by adding methanol containing 1% formic acid.

  • Purify the reaction products using SPE columns, washing with water containing 1% formic acid.

  • Elute residual NBD-sphinganine with a 30:14:6:1 solution of methanol:water:chloroform:formic acid containing 10 mM ammonium acetate.

  • Elute and collect NBD-ceramide with a 30:14:6:1 solution of methanol:chloroform:water:formic acid containing 10 mM ammonium acetate.

  • Measure sample fluorescence intensity using a multiwell plate reader (NBD λex = 465 nm, λem = 535 nm).

  • Quantify NBD-ceramide using a standard curve .

This method allows for precise measurement of CERS2 activity when utilizing very-long-chain acyl-CoAs as substrates and has been successfully employed to demonstrate a 42% reduction in CERS2 activity in liver tissue from mice harboring the rs267738 mutation .

How can CERS2 gene mutations be effectively modeled in experimental systems?

CERS2 gene mutations can be modeled through several approaches, with CRISPR/Cas9 technology emerging as a particularly effective method. A successful strategy for modeling the human rs267738 SNP (E115A substitution) in CERS2 includes:

  • Design guide RNA (gRNA) directing Cas9-mediated cutting near the target nucleotide.

  • Generate a single-stranded oligodeoxynucleotide (ssODN) donor to introduce the knock-in mutation, incorporating stabilizing 5' and 3' phosphorothioate modifications and a mutated protospacer adjacent motif sequence that creates a unique restriction enzyme cut site.

  • Co-microinject the ribonucleoprotein complex of gRNA and Cas9 protein with the ssODN donor into embryo pronuclei.

  • Screen founders by PCR amplification of restriction enzyme digests and Sanger sequencing.

  • Cross positive founders with wildtype mice to generate a research colony .

This approach has been successfully used to create mouse models that accurately recapitulate the functional consequences of CERS2 mutations, including altered enzyme activity and metabolic phenotypes . Alternative approaches include generating CerS2 null mice to study complete loss of function, which has revealed the non-redundant role of CERS2 in very-long-chain ceramide synthesis in liver, kidney, and brain tissues .

What are the key considerations when designing experiments to study CERS2 regulation by phosphorylation?

When investigating CERS2 regulation by phosphorylation, researchers should consider:

  • Kinase selection: Casein Kinase 2 (CK2) has been identified as an important regulator of ceramide synthase activity through phosphorylation . In vitro kinase assays should include:

    • Reaction buffer (20 mM Tris-HCl, pH 7.5, 50 mM KCl, 10 mM MnCl₂)

    • Purified recombinant human CK2 (~1 μg)

    • Purified wildtype or phosphorylation site mutant CERS2

    • ATP mix (2 mM ATP, radiolabeled [γ-³²P]ATP for detection)

  • Phosphorylation site identification: Mass spectrometry analysis of purified CERS2 after in vitro phosphorylation can identify specific phosphorylation sites.

  • Mutagenesis studies: Creating serine/threonine to alanine mutations at potential phosphorylation sites to assess their functional importance.

  • Correlation with activity: Measuring CERS2 enzymatic activity in parallel with phosphorylation status using the NBD-sphinganine assay described above.

  • Cellular context: Evaluating phosphorylation in different cellular contexts, as CK2 activity and CERS2 phosphorylation may vary depending on cell type or physiological state .

Research has shown that CK2-dependent phosphorylation is essential for ceramide synthase activity and cell viability, making this a critical area of investigation for understanding CERS2 regulation .

What are common challenges in purifying functional recombinant CERS2 and how can they be addressed?

Purifying functional recombinant CERS2 presents several challenges due to its transmembrane nature and complex structure. Common issues and solutions include:

  • Low protein yield:

    • Optimize expression conditions (temperature, induction time, media composition)

    • Consider using fusion tags that enhance solubility (MBP, SUMO)

    • Use specialized detergents optimized for membrane proteins

  • Poor solubility:

    • Use appropriate detergents (e.g., DDM, CHAPS, or digitonin)

    • Incorporate phospholipids during purification to stabilize the protein

    • Maintain glycerol (10%) in purification buffers

  • Loss of activity during purification:

    • Minimize time between purification steps

    • Include protease inhibitors throughout the process

    • Maintain proper pH and ionic strength (typically pH 7.3-7.5)

    • Use affinity purification methods (anti-DDK columns) followed by conventional chromatography

  • Protein aggregation:

    • Include stabilizing agents such as glycerol (10%) and appropriate buffers (25 mM Tris-HCl, 100 mM glycine)

    • Filter solutions before concentration steps

    • Maintain cold temperature throughout purification

Successful purification of recombinant CERS2 with retained activity has been achieved using anti-DDK affinity columns followed by conventional chromatography steps, resulting in preparations with >80% purity as determined by SDS-PAGE and Coomassie blue staining .

How can researchers address contradictory findings regarding CERS2 expression and function in different cancer types?

The literature contains seemingly contradictory findings regarding CERS2 expression and function in cancer. To address these contradictions, researchers should:

  • Standardize detection methods:

    • Use multiple approaches to measure CERS2 (qPCR, Western blot, immunohistochemistry)

    • Validate antibodies for specificity

    • Consider examining both mRNA and protein levels, as post-transcriptional regulation may occur

  • Account for alternative splicing:

    • Design experiments to detect specific CERS2 splice variants

    • Recognize that Exon 8 skipping in CERS2 has been identified in Luminal B breast cancer subtype and affects enzyme activity and substrate specificity

    • Use primers/antibodies that can distinguish between splice variants

  • Consider tissue-specific effects:

    • In bladder cancer, CERS2 expression decreases as malignancy stage increases

    • In breast cancer, decreased CERS2 levels correlate with increased cell proliferation, metastasis, and poor patient survival

    • Evaluate CERS2 function in the specific cancer context being studied

  • Examine functional consequences:

    • Measure ceramide profiles, particularly very-long-chain species

    • Assess downstream signaling pathways

    • Consider the balance between different ceramide species rather than total ceramide levels

By carefully addressing these considerations, researchers can better understand the seemingly contradictory roles of CERS2 in different cancer contexts. For instance, in breast cancer, there is a negative correlation between CERS2 expression and malignant potential of cell lines, with lack of CERS2 expression serving as a poor prognostic factor associated with cancer progression and invasion .

How can recombinant CERS2 be used to investigate the therapeutic potential of CERS2 activators in cancer treatment?

Recombinant CERS2 provides a valuable tool for investigating CERS2 activators as potential cancer therapeutics:

  • High-throughput screening platforms:

    • Develop fluorescence-based assays using recombinant CERS2 and NBD-sphinganine for screening compound libraries

    • Establish counter-screens with other ceramide synthases to identify CERS2-specific activators

    • Validate hits with secondary assays measuring native ceramide production

  • Structure-activity relationship studies:

    • Use purified recombinant CERS2 to study binding interactions with potential activators

    • Perform computational modeling of activator binding using the CERS2 structure

    • Develop rational design strategies for optimizing lead compounds

  • Mechanistic validation:

    • Test promising compounds like biisoquinolinederivative (DH20931), which has been identified as a CERS2 stimulator that induces lipotoxic and endoplasmic reticulum stress as well as apoptosis in breast cancer cells

    • Evaluate effects on CERS2 activity, substrate specificity, and resulting ceramide profiles

    • Assess impact on downstream pathways, including apoptosis induction through BCL-2 downregulation, cytochrome c release, and activation of procaspase-9 and procaspase-3

  • Preclinical translation:

    • Use recombinant CERS2 to standardize activity assays for evaluating compound efficacy

    • Develop predictive biomarkers based on CERS2 activity or expression levels

    • Design combination strategies with existing therapies

The therapeutic potential of CERS2 activation is supported by research showing that decreased levels of CERS2 are linked with increased cell proliferation and metastasis, and poor survival of patients with breast cancer . The discovery that DH20931 acts as a CERS2 stimulator with anti-cancer properties offers a promising avenue for developing novel cancer therapeutics targeting this enzyme .

What methodologies can be employed to study the impact of CERS2 polymorphisms on sphingolipid metabolism and disease risk?

Studying the impact of CERS2 polymorphisms requires an integrated approach combining genetic, biochemical, and clinical methodologies:

  • Genetic analysis:

    • Genome-wide association studies (GWAS) to identify associations between CERS2 SNPs and disease phenotypes

    • Targeted genotyping of known polymorphisms (e.g., rs267738) in case-control cohorts

    • In silico prediction of SNP effects on protein function using tools that assess amino acid substitution consequences

  • Functional characterization:

    • Generate CRISPR knock-in models of specific polymorphisms

    • Measure enzyme activity using fluorescent or radioactive substrate assays

    • Compare wildtype and mutant CERS2 for changes in substrate specificity, kinetic parameters, and stability

  • Lipidomic profiling:

    • Perform mass spectrometry-based targeted lipidomics on biological samples from individuals with different CERS2 genotypes

    • Analyze changes in ceramide and sphingolipid profiles, focusing on very-long-chain species

    • Correlate lipid alterations with physiological parameters and disease risk

  • Metabolic phenotyping:

    • In mouse models, assess glucose tolerance, insulin sensitivity, and hepatic steatosis

    • In human cohorts, correlate CERS2 genotypes with metabolic parameters

    • Evaluate risk scores for disease outcomes based on ceramide profiles

This integrated approach has been successfully employed to characterize the rs267738 polymorphism in CERS2, which causes an E115A substitution predicted to be deleterious for enzyme function. Studies in knock-in mice demonstrated reduced liver CERS2 activity (42% reduction) and enhanced diet-induced glucose intolerance and hepatic steatosis, although human serum sphingolipids and ceramide-based cardiac event risk scores were not significantly affected by rs267738 allele count in a study of 567 serum samples .

How can alternative splicing of CERS2 be experimentally validated and its functional consequences assessed?

Alternative splicing of CERS2 can significantly impact its function, as demonstrated by the Exon 8 skipping event observed in Luminal B breast cancer. To validate and assess the functional consequences of alternative splicing:

  • Splicing identification and validation:

    • Analyze RNA-seq data from relevant tissues/cells to identify potential alternative splicing events

    • Validate splice variants using RT-PCR with primers flanking the alternatively spliced regions

    • Quantify the relative abundance of splice variants using qRT-PCR or digital PCR

    • Confirm protein expression of splice variants by Western blotting using isoform-specific antibodies when possible

  • Expression system optimization:

    • Clone full-length and alternatively spliced CERS2 variants into expression vectors

    • Express recombinant proteins in appropriate systems (typically mammalian cells for functional studies)

    • Purify proteins for biochemical characterization or use whole cell systems for functional analyses

  • Functional characterization:

    • Compare enzymatic activity of different splice variants using fluorescent substrate assays

    • Analyze substrate specificity by testing activity with acyl-CoAs of different chain lengths

    • Assess subcellular localization using fluorescent tags or immunofluorescence

    • Evaluate protein-protein interactions that might be affected by alternative splicing

  • Impact on sphingolipid metabolism:

    • Perform lipidomic profiling of cells expressing different splice variants

    • Measure changes in ceramide levels, particularly very-long-chain species

    • Analyze downstream effects on complex sphingolipids

  • Cellular and physiological consequences:

    • Assess effects on cell proliferation, migration, and apoptosis

    • Evaluate impact on signaling pathways known to be regulated by ceramides

    • Analyze correlation between splice variant expression and clinical outcomes

Research has shown that skipping of Exon 8 in CERS2 significantly affects survival in Luminal B breast cancer patients and is a poor prognostic factor. This splicing event contributes to the lack of catalytic activity and substrate specificity of CERS2 for very-long-chain ceramides, reducing the levels of these ceramides and thereby affecting cancer cell proliferation and migration .

What is the significance of CERS2 in liver homeostasis and how can recombinant CERS2 be used to study liver diseases?

CERS2 plays a critical role in liver homeostasis through its regulation of sphingolipid composition. Research using CerS2 null mice has revealed that:

  • CERS2 deficiency alters sphingolipid composition:

    • Ceramide and downstream sphingolipids become devoid of very-long-chain (C22-C24) acyl chains

    • Compensatory increase in C16-ceramide levels occurs, maintaining total ceramide levels

    • Massive elevation (approximately 50-fold) of sphinganine is observed

  • Physiological consequences of altered sphingolipid composition:

    • Changes in membrane properties and fluidity

    • Alterations in lipid raft composition affecting signaling pathways

    • Disruption of cellular processes dependent on proper sphingolipid balance

Recombinant CERS2 can be utilized to study liver diseases through:

  • Functional replacement studies:

    • Introducing wildtype or mutant recombinant CERS2 into CerS2-deficient models

    • Assessing rescue of phenotypes to determine structure-function relationships

    • Evaluating the impact of specific CERS2 domains on liver homeostasis

  • Drug discovery applications:

    • Screening for compounds that modulate CERS2 activity

    • Testing potential therapeutics for liver diseases associated with altered sphingolipid metabolism

    • Developing biomarkers based on CERS2 activity or sphingolipid profiles

  • Mechanistic studies:

    • Investigating interactions between CERS2 and other proteins involved in liver metabolism

    • Examining how CERS2 activity is regulated in response to metabolic stress

    • Exploring the role of CERS2 in lipid-mediated signaling pathways

The importance of CERS2 in liver homeostasis is underscored by studies showing that CerS2 null mice develop hepatopathy, highlighting the non-redundant role of this enzyme in maintaining proper liver function through regulation of sphingolipid composition .

How do changes in CERS2 activity influence cell survival and apoptosis in cancer models?

CERS2 activity significantly impacts cell survival and apoptotic pathways in cancer models through multiple mechanisms:

  • Regulation of pro-apoptotic ceramide species:

    • CERS2 promotes apoptosis of tumor cells through ceramide production

    • Overexpression of CERS2 induces downregulation of BCL-2 (anti-apoptotic protein)

    • This leads to release of cytochrome c from mitochondria

    • Subsequently activates procaspase-9 and procaspase-3

    • Results in cleavage of poly(ADP-ribose) polymerase 1 (PARP1)

  • Induction of oncogene-induced senescence:

    • Very-long-chain ceramides produced by CERS2 can trigger oncogenic-induced senescence

    • This has been particularly observed in the context of K-RAS-induced senescence

    • Senescence serves as a tumor-suppressive mechanism in early cancer development

  • Correlation with cancer progression:

    • In bladder cancer, CERS2 expression decreases as malignancy stage increases at both protein and mRNA levels

    • Silencing CERS2 in xenograft models with highly invasive human bladder cancer cell lines results in significantly increased tumor volumes

    • A particular SNP that reduces CERS2 transcript abundance acts as an independent risk factor for bladder cancer susceptibility and poor clinical prognosis

  • Therapeutic targeting potential:

    • Stimulation of CERS2 activity (e.g., by DH20931) induces lipotoxic and endoplasmic reticulum stress

    • This leads to apoptosis in breast cancer cells

    • Decreased levels of CERS2 have been linked with increased cell proliferation, metastasis, and poor survival in breast cancer patients

These findings highlight the potential of targeting CERS2 activity as a therapeutic approach in cancer treatment, particularly through stimulating its activity to promote cancer cell death through apoptotic and stress-related pathways.

What are emerging technologies that could advance our understanding of CERS2 function and regulation?

Several cutting-edge technologies are poised to significantly advance our understanding of CERS2 function and regulation:

  • Cryo-electron microscopy (Cryo-EM):

    • Determining high-resolution structures of CERS2 alone and in complex with substrates

    • Visualizing conformational changes during catalysis

    • Understanding the structural basis for substrate specificity

    • Identifying potential regulatory binding sites for drug development

  • Proximity labeling proteomics:

    • Using BioID or APEX2 fusions with CERS2 to identify proximal proteins in living cells

    • Mapping the CERS2 interactome in different cellular contexts

    • Discovering novel regulatory proteins or cofactors

    • Understanding how protein-protein interactions change under different conditions

  • CRISPR-based functional genomics:

    • Performing genome-wide CRISPR screens to identify genes that modify CERS2 function

    • Using CRISPRa/CRISPRi to modulate CERS2 expression in diverse cellular contexts

    • Applying base editing to introduce specific mutations for structure-function analysis

    • Developing tissue-specific or inducible CERS2 knockout/knockin models

  • Single-cell multi-omics:

    • Combining single-cell transcriptomics, proteomics, and lipidomics

    • Analyzing cell-to-cell variation in CERS2 expression and function

    • Correlating CERS2 activity with sphingolipid profiles at single-cell resolution

    • Understanding heterogeneity in CERS2 regulation within tissues

  • Synthetic biology approaches:

    • Engineering CERS2 variants with altered substrate specificity

    • Creating optogenetic tools to control CERS2 activity with light

    • Developing biosensors to monitor ceramide production in real-time

    • Designing minimal systems to study CERS2 function in defined membrane environments

These technologies will enable researchers to address fundamental questions about CERS2 biology and potentially develop novel therapeutic strategies targeting this important enzyme in various disease contexts.

What are the most promising approaches for targeting CERS2 in disease treatment, and how can recombinant CERS2 facilitate their development?

The therapeutic targeting of CERS2 represents a promising frontier in disease treatment, with several approaches showing particular potential:

  • CERS2 activators for cancer therapy:

    • Small molecule activators like DH20931 (biisoquinolinederivative) that stimulate CERS2 activity

    • Induction of apoptosis in cancer cells through increased production of very-long-chain ceramides

    • Combination therapies with existing cancer treatments to enhance efficacy

    • Potential for targeted delivery to cancer cells to minimize off-target effects

  • CERS2 modulators for metabolic disease:

    • Compounds that normalize CERS2 activity in individuals with dysfunctional variants (e.g., rs267738)

    • Targeting hepatic steatosis and glucose intolerance associated with CERS2 dysfunction

    • Personalized approaches based on individual CERS2 genotypes and ceramide profiles

  • Gene therapy approaches:

    • Delivery of functional CERS2 to tissues with deficient activity

    • Correction of splice variants associated with disease (e.g., Exon 8 skipping in breast cancer)

    • CRISPR-based editing to correct pathogenic CERS2 mutations

Recombinant CERS2 facilitates these therapeutic developments through:

  • Structure-based drug design:

    • High-quality recombinant protein for crystallization or cryo-EM studies

    • Identification of binding sites for small molecule modulators

    • Rational design of compounds that enhance or regulate CERS2 activity

  • Screening platforms:

    • Development of high-throughput assays using recombinant CERS2

    • Testing libraries of compounds for modulation of enzyme activity

    • Validation of hits in cellular and animal models

  • Biomarker development:

    • Standardized activity assays for measuring CERS2 function in patient samples

    • Correlation of enzyme activity with disease progression and treatment response

    • Development of companion diagnostics for CERS2-targeted therapies

  • Safety and efficacy assessment:

    • Evaluating potential off-target effects of CERS2 modulators

    • Understanding compensatory mechanisms in response to altered CERS2 activity

    • Optimizing dosing regimens for maximal therapeutic benefit

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.