Recombinant Human Ceramide synthase 3 (CERS3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CERS3; LASS3; Ceramide synthase 3; CerS3; Dihydroceramide synthase 3; LAG1 longevity assurance homolog 3; Sphingosine N-acyltransferase CERS3; Ultra-long-chain ceramide synthase CERS3; Very-long-chain ceramide synthase CERS3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-383
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CERS3
Target Protein Sequence
MFWTFKEWFWLERFWLPPTIKWSDLEDHDGLVFVKPSHLYVTIPYAFLLLIIRRVFEKFV ASPLAKSFGIKETVRKVTPNTVLENFFKHSTRQPLQTDIYGLAKKCNLTERQVERWFRSR RNQERPSRLKKFQEACWRFAFYLMITVAGIAFLYDKPWLYDLWEVWNGYPKQPLLPSQYW YYILEMSFYWSLLFRLGFDVKRKDFLAHIIHHLAAISLMSFSWCANYIRSGTLVMIVHDV ADIWLESAKMFSYAGWTQTCNTLFFIFSTIFFISRLIVFPFWILYCTLILPMYHLEPFFS YIFLNLQLMILQVLHLYWGYYILKMLNRCIFMKSIQDVRSDDEDYEEEEEEEEEEATKGK EMDCLKNGLRAERHLIPNGQHGH
Uniprot No.

Target Background

Function
Ceramide synthase 3 (CERS3) is an enzyme responsible for catalyzing the transfer of an acyl chain from acyl-CoA to a sphingoid base. It exhibits high selectivity towards very- and ultra-long-chain fatty acyl-CoA (chain length exceeding C22). CERS3 N-acylates both sphinganine and sphingosine bases, leading to the formation of dihydroceramides and ceramides, respectively, within the de novo synthesis and salvage pathways. CERS3 is crucial for the synthesis of ultra-long-chain ceramides in the epidermis, playing a critical role in maintaining epidermal lipid homeostasis and terminal differentiation.
Gene References Into Functions
  1. Novel mutations in CERS3 have been found to co-segregate with the ichthyosis phenotype in six Iranian families. PMID: 28875980
  2. Testis-specific sphingolipids, which are linked to CerS3 in human testis, are crucial for male fertility. PMID: 26045466
  3. Research has shown that the synthesis of very long chain ceramides by CerS3 is a crucial early step in skin barrier formation. This finding links disorders presenting with congenital ichthyosis to defects in sphingolipid metabolism and lipid architecture. PMID: 23549421
  4. These studies provide evidence for a novel pathway involved in autosomal recessive congenital ichthyosis (ARCI) development. They also demonstrate that CERS3 plays a vital role in human sphingolipid metabolism for maintaining epidermal lipid homeostasis. PMID: 23754960
Database Links

HGNC: 23752

OMIM: 615023

KEGG: hsa:204219

STRING: 9606.ENSP00000284382

UniGene: Hs.662371

Involvement In Disease
Ichthyosis, congenital, autosomal recessive 9 (ARCI9)
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the epidermis, where it localizes at the interface between the stratum granulosum and the stratum corneum (at protein level).

Q&A

What is CERS3 and what is its primary function in human tissue?

CERS3 (Ceramide Synthase 3) is one of six mammalian ceramide synthases (CerS1-CerS6) that catalyze the formation of ceramides from sphingoid base and acyl-CoA substrates. It occupies a unique metabolic niche by simultaneously regulating de novo sphingolipid synthesis and recycling free sphingosine produced from sphingolipid degradation through the salvage pathway .

CERS3 is primarily responsible for the synthesis of ultra-long ceramides (>C26) in the epidermis, which are critical components for proper skin barrier function . This enzyme shows the highest affinity for dihydrosphingosine among all CerS isoforms, with a Km value of approximately 1.7 μM . CERS3 is predominantly expressed in skin and testis, indicating tissue-specific functions .

How does CERS3 differ from other ceramide synthases in terms of substrate specificity?

CERS3 demonstrates distinct substrate specificity compared to other ceramide synthases, particularly regarding acyl-chain length preference. While other CerS enzymes typically produce ceramides with shorter acyl chains, CERS3 specifically generates ultra-long chain ceramides (>C26) .

Recent studies with CERS3-deficient animals have conclusively demonstrated this specificity, as these models lack ultra-long ceramides in the epidermis . In terms of sphingoid base preference, CERS3 has the highest affinity for dihydrosphingosine among all CerS isoforms, with a Km value of 1.7 μM compared to 4.8 μM for CERS2 . This unique substrate preference contributes to the production of specific ceramide species essential for proper skin barrier function.

What are the consequences of CERS3 deficiency in human subjects?

CERS3 deficiency in humans causes autosomal recessive congenital ichthyosis (ARCI), a severe skin condition characterized by collodion membranes at birth, generalized scaling of the skin, and mild erythroderma .

At the molecular level, CERS3 deficiency leads to a specific loss of very long acyl chain ceramides from C26 up to C34 in terminally differentiating keratinocytes . This ceramide deficiency disrupts epidermal differentiation, causing earlier maturation and significant impairment of the epidermal barrier function . These findings demonstrate that the synthesis of very long chain ceramides by CERS3 represents a crucial early step in skin barrier formation and links ichthyotic disorders to defects in sphingolipid metabolism and epidermal lipid architecture.

What expression systems are used for producing recombinant human CERS3 for research?

Recombinant human CERS3 can be expressed through several methodological approaches:

  • Viral vector systems: Recombinant adeno-associated virus 8 (rAAV8) vectors containing the CERS3 gene have been successfully used in research models . These vectors can be designed with specific promoters, such as the human G-protein-coupled receptor kinase 1 (hGRK1) promotor, to achieve targeted expression in specific cell types like photoreceptor cells .

  • Inducible expression systems: Research has employed doxycycline-inducible shRNA knockdown systems in human keratinocytes to create tunable models of CERS3 deficiency . This approach allows for controlled expression levels and can be used to study both the effects of CERS3 reduction and the recovery processes following restoration of expression.

  • Tagging strategies: When cloning CERS3 for expression, sequence encoding an N-terminal FLAG tag can be included in the vector to facilitate detection of the expressed protein using standard immunological techniques .

How can researchers measure CERS3 enzymatic activity in experimental models?

CERS3 enzymatic activity can be evaluated through several methodological approaches:

  • N-acylation assays: These assays measure the capability of CERS3 to catalyze N-acylation with various acyl-CoAs (particularly C26-CoA). Researchers can use this approach in both patient keratinocytes and with recombinant mutant proteins to assess enzymatic function .

  • Targeted metabolomics analyses: This approach quantifies ceramide species with varying acyl chain lengths (particularly C16, C18, C20, and longer chain ceramides up to C34) to evaluate CERS3 activity. The method is particularly valuable for analyzing the impact of CERS3 mutations or deficiency on ceramide profiles in biological samples .

  • Kinetic analysis: Determination of Km values for different substrates, particularly dihydrosphingosine, can be conducted using microsomes prepared from cells overexpressing CERS3. This approach allows comparison of substrate affinities between different CerS isoforms .

What human skin equivalent (HSE) models are available for studying CERS3 function?

Human skin equivalent (HSE) models provide valuable platforms for studying CERS3 function in a controlled environment that recapitulates key aspects of human skin biology:

  • Inducible knockdown HSE models: Recent research has developed HSE models with doxycycline-inducible CERS3 knockdown using engineered keratinocytes . This system allows for tunable depletion of ceramides and enables researchers to study the consequences of CERS3 deficiency on epidermal lipid composition.

  • Reversible models for studying recovery: The inducible nature of these HSE models permits removal of doxycycline to restore CERS3 expression, enabling studies of recovery and repair processes in epidermal lipids following acute ceramide depletion .

  • Analytical capabilities: These models facilitate comprehensive analysis of how CERS3 reduction affects the global lipid profile of the epidermis, including changes in specific ceramide classes and alterations in ceramide chain length distributions .

The reversibility of inducible CERS3 knockdown in these models provides a unique advantage for studying the kinetics of lipid recovery within HSEs, offering insights into repair mechanisms following ceramide depletion .

How does CERS3 dysfunction contribute to skin barrier disorders at the molecular level?

CERS3 dysfunction disrupts skin barrier formation through several molecular mechanisms:

  • Altered ceramide profiles: CERS3 deficiency leads to a specific loss of ceramides with very long acyl chains (C26-C34) in terminally differentiating keratinocytes . This alters the lipid composition critical for proper barrier function.

  • Disturbed epidermal differentiation: The lack of specific ceramide species results in premature maturation of the epidermis and disrupts the orderly process of terminal differentiation .

  • Compromised lipid architecture: The absence of ultra-long chain ceramides impairs the organization of lipids in the stratum corneum, which is essential for the barrier properties of skin .

  • Global lipid disruption: Studies with inducible CERS3 knockdown models have demonstrated that reduction in CERS3 expression results in not only specific ceramide depletion but also global disruption of polar lipids within the epidermis .

These molecular alterations collectively lead to barrier dysfunction manifesting as clinical conditions such as autosomal recessive congenital ichthyosis (ARCI) .

What rescue strategies have been explored for CERS3 deficiency in experimental models?

Several rescue strategies have been investigated to address CERS3 deficiency in experimental models:

  • Gene therapy approaches: Subretinal injection of recombinant adeno-associated virus 8 (rAAV8) vector containing the CERS3 gene has successfully restored ceramide levels and rescued phenotypes in CERS3-deficient models .

  • Ceramide compensation strategies: Interesting alternative approaches involve the overexpression of other ceramide synthases (CerS2, CerS4, CerS5) to compensate for CERS3 deficiency . In a retinal dystrophy mouse model, injection of rAAV8-CerS vectors restored retinal functions as indicated by improved electroretinogram responses .

  • Targeted ceramide species replacement: Research has shown that different ceramide species have different impacts on affected tissues, suggesting that targeted replacement of specific ceramide species might be more effective than global ceramide supplementation .

  • Reversible knockdown models: The development of doxycycline-inducible knockdown systems allows for the study of recovery mechanisms when CERS3 expression is restored, providing insights into natural repair processes that could be therapeutically enhanced .

What are the key considerations when designing CERS3 expression constructs?

When designing CERS3 expression constructs for research applications, several factors should be considered:

  • Promoter selection: Choosing appropriate promoters is critical for targeted expression. For instance, the human G-protein-coupled receptor kinase 1 (hGRK1) promoter has been successfully used to achieve targeted expression in photoreceptor cells .

  • Tagging strategies: Incorporation of detection tags, such as an N-terminal FLAG tag, facilitates monitoring of CERS3 expression in experimental systems . These tags should be positioned to minimize interference with enzymatic activity.

  • Vector selection: The choice between viral vectors (such as rAAV8) and plasmid-based systems depends on the target tissue and delivery requirements. Viral vectors often provide better in vivo delivery efficiency .

  • Regulatory elements: Inclusion of inducible elements, such as tetracycline-responsive promoters, allows for controlled expression or knockdown of CERS3, enabling more nuanced studies of its function .

  • Species considerations: When designing constructs, researchers should account for potential species-specific differences in CERS3 function and regulation, particularly when translating findings between model organisms and humans.

How can ceramide profiles be comprehensively analyzed in CERS3 research?

Comprehensive analysis of ceramide profiles is essential in CERS3 research and can be accomplished through several methodological approaches:

  • Targeted metabolomics: This approach focuses specifically on ceramide species and enables quantification of ceramides with varying acyl chain lengths, particularly the ultra-long chain ceramides (>C26) produced by CERS3 .

  • Lipidomic analysis: Broader lipidomic approaches can reveal how CERS3 manipulation affects not only ceramides but also related sphingolipid classes and the global lipid composition of tissues or cells .

  • Chain length distribution analysis: Specific analytical methods can determine the relative abundance of ceramides with different acyl chain lengths, providing insights into how CERS3 deficiency or overexpression shifts the distribution of these species .

  • Temporal profiling: In models with inducible CERS3 expression or knockdown, time-course analyses can reveal the dynamics of ceramide synthesis and degradation, offering insights into the kinetics of these processes .

  • Spatial analysis: Techniques such as imaging mass spectrometry can provide information about the spatial distribution of ceramide species in tissues, which is particularly relevant for understanding CERS3 function in stratified tissues like the epidermis.

What are the current limitations in studying recombinant human CERS3?

Research on recombinant human CERS3 faces several methodological and conceptual challenges:

  • Enzyme localization and membrane integration: As an integral membrane protein, CERS3 presents challenges for expression, purification, and structural studies compared to soluble proteins .

  • Substrate complexity: Working with very long-chain acyl-CoAs (>C26) presents technical difficulties due to their limited commercial availability and handling properties .

  • Functional redundancy: Partial functional overlap between different CerS enzymes can complicate the interpretation of results from CERS3 manipulation studies .

  • Tissue-specific effects: CERS3's predominant expression in skin and testis means that findings in other cell types or tissues may not fully reflect its physiological roles .

  • Translation between models: Differences in lipid metabolism between commonly used model organisms and humans can limit the translational value of some experimental findings .

What emerging technologies show promise for advancing CERS3 research?

Several emerging technologies and approaches hold significant promise for advancing CERS3 research:

  • Inducible human skin equivalents: The development of human skin equivalents with inducible CERS3 knockdown provides tunable models for studying ceramide deficiency and recovery processes .

  • CRISPR/Cas9 gene editing: This technology enables precise manipulation of CERS3 in relevant cell types and the creation of isogenic cell lines that differ only in CERS3 status.

  • Single-cell omics: Application of single-cell transcriptomics and lipidomics could reveal cell-type-specific functions of CERS3 and heterogeneity in responses to its manipulation.

  • Computational modeling: Integration of experimental data with computational approaches could help predict the consequences of CERS3 alterations on complex lipid networks and barrier function.

  • Advanced imaging techniques: Emerging imaging modalities could provide new insights into the subcellular localization and trafficking of CERS3 and its products in living cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.